KEGG   Lactobacillus parabuchneri: FAM21731_01746Help
Entry
FAM21731_01746    CDS       T04617                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lpar  Lactobacillus parabuchneri
Pathway
lpar00970  Aminoacyl-tRNA biosynthesis
lpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FAM21731_01746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpar03029]
    FAM21731_01746
Enzymes [BR:lpar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     FAM21731_01746
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     FAM21731_01746
Mitochondrial biogenesis [BR:lpar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    FAM21731_01746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APR07909
UniProt: A0A1X1FDJ5
LinkDB All DBs
Position
1815551..1817014
Genome map
AA seq 487 aa AA seqDB search
MNYFDQSLSSIHEQLVNKEISAKDLTQQTLDNIKSVDGDINAFITVDEDGALKKAQAVDE
KGIDAENLLSGMPIAIKDNMVTKGLKTTAASKILENFKPIYDATAVEKLNDLGTITVGKT
NMDEFAMGGSTENSAFKITHNPWDTTKVPGGSSGGSAAAVAAGEVIAALGSDTGGSIRQP
ASFNGVVGMKPTYGRVSRWGLIAFGSSLDQIGPITRNVSDNATIMNAIAGHDSHDLTSST
KEVPDFTSTLTKGVKGMKIGIPTEFMAQGLDDDIKQTVLKTAETFKKLGATVEDVSLPHT
KYGVAAYYIISSSEASSNLQRFDGIRYGRRAKDVKDLEDLYVKSRSEGFGDEVKRRIMLG
TFSLSAGFYDAYFKKAAQVRTLMINDFTNVFKDFDLILAPTAPTPAYGIGEDVSDPMTMY
MNDVLTLPVNLAGLPGMSIPAGFSNGLPVGVQLIGRPFDELTVYQAGNAFEQETDFGKQT
PKMGGNN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaattattttgaccaatcattaagtagtattcacgaacaactcgtcaacaaagaaatt
tctgccaaagatttaacccaacagactttggataatattaaaagtgttgatggtgatatc
aacgcttttattacggttgacgaagatggtgctttgaaaaaggcccaagccgttgatgaa
aaaggaattgacgccgaaaacttgttatcagggatgccaattgccatcaaggacaacatg
gttaccaaagggctcaaaacaacggccgcatccaagattcttgaaaactttaagccaatt
tatgatgcaactgccgttgaaaaattgaacgaccttggcacgatcaccgttggtaaaacc
aatatggatgaatttgccatgggtggttcaactgaaaattctgccttcaaaattacccat
aacccttgggataccactaaagttcctggtggttcatcaggtgggtctgctgccgctgtt
gctgcaggtgaagtgattgctgctttgggttcggatacgggtggctcaattcgtcagcca
gcctcatttaacggggttgttgggatgaaaccaacctatggccgtgtttcccgttggggc
ttaattgcctttgggtcaagcctggatcaaatcggcccgattactcgaaacgtttctgat
aacgccacaattatgaatgcgattgccggacatgacagtcatgacctgacatcgtctacg
aaggaagttcctgattttaccagcaccttgactaagggtgttaaaggaatgaagattgga
attccaactgagtttatggctcagggacttgatgacgatattaagcaaaccgttttgaaa
acggctgaaaccttcaaaaaactaggggcaacagtcgaagacgtttccttgccacatacc
aaatatggtgtggccgcttattacatcatttcgtcttcggaagcttcttcaaacttacag
cgatttgatggcattcgttatggccgtcgtgccaaggacgttaaggaccttgaagacttg
tacgttaagtcgcgttctgaaggatttggtgatgaagtcaagcgtcgaatcatgcttggg
acgttctcactttccgctggattttacgatgcctactttaagaaggctgctcaagtccgg
acgctgatgattaatgattttaccaacgtctttaaggactttgacttaatcttggcgcca
accgcaccaacaccagcttatggaattggtgaagacgtgtcggatccaatgaccatgtac
atgaacgatgtattaacactaccagttaatttagcagggcttccaggaatgtcgattcct
gccggcttctcgaatgggttaccagttggcgttcagctgattggccgaccttttgatgaa
ttgaccgtttatcaagcaggaaatgcttttgaacaagaaactgattttggcaagcaaaca
ccaaagatgggaggaaacaactaa

DBGET integrated database retrieval system