KEGG   Lactobacillus plantarum B21: SH83_03255Help
Entry
SH83_03255        CDS       T03680                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SH83_03255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpb03400]
    SH83_03255
Enzymes [BR:lpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SH83_03255
DNA repair and recombination proteins [BR:lpb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SH83_03255
 Prokaryotic type
     SH83_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AJO73413
UniProt: A0A165PWM5
LinkDB All DBs
Position
721527..722219
Genome map
AA seq 230 aa AA seqDB search
MKAFIHTDWWDVLKPEFEKPYYHQLHEFLKNEYRTKNIHPDMYNIFQAFEWTPFADTKVV
ILGQDPYHGPGQAHGLSFSVLPGVAVPPSLVNIYKELQNDVGCTPVNHGYLESWAKQGVL
LLNSVLTVQNGVAFSHAGKGWERLTDVAIQRLSERSTPVVFILWGKAARSKIKLIDTQTN
VVLQAPHPSPLSAYRGFFGSKPFSKTNIALTSFGEQPINWQLPEHVNLEH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtttattcacacggactggtgggacgtcttaaaaccagagtttgagaagccg
tattaccaccaattacacgaatttttgaaaaatgaataccgaacgaaaaatattcaccca
gatatgtataatatttttcaggcctttgaatggacgccatttgctgacacgaaggtcgtt
attttaggtcaggatccgtatcatggtcctggtcaggcacacggactgagtttttcagtg
ttaccgggcgtggcagtgcccccatcactagtcaatatctataaagaattgcaaaatgat
gttgggtgtacgcccgtcaaccacggttacttggaaagttgggccaagcagggagtcttg
ttattgaactccgtgctgactgttcaaaatggtgtggccttttcacacgctggtaagggc
tgggaacgacttacggacgttgccattcagcgtttatcggaacgatcgacgccggttgtc
tttatcttgtggggtaaggcggctcggtccaagattaagctgattgatacccagacgaat
gtcgtgctacaagcacctcatccgagtccgctttcagcttatcgcggattctttgggtcc
aaaccattttcaaaaacgaacattgcgttaacatccttcggcgaacagccaatcaattgg
cagttaccagagcacgtcaatcttgagcattaa

DBGET integrated database retrieval system