KEGG   Lactobacillus plantarum B21: SH83_04480Help
Entry
SH83_04480        CDS       T03680                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00030  Pentose phosphate pathway
lpb01100  Metabolic pathways
lpb01110  Biosynthesis of secondary metabolites
lpb01120  Microbial metabolism in diverse environments
lpb01130  Biosynthesis of antibiotics
lpb01200  Carbon metabolism
lpb01230  Biosynthesis of amino acids
Module
lpb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lpb_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SH83_04480
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SH83_04480
Enzymes [BR:lpb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SH83_04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AJO73634
LinkDB All DBs
Position
979044..981056
Genome map
AA seq 670 aa AA seqDB search
MQAFDEIDELAVNNLRVLSAEMIERAGSGHPGLPLGAAPMMWVLWSRQLRVDPQQSQWAN
RDRFVLSAGHGSALLYSLLHVSGFNVTMGELQRFRQFGSHTPGHPELGIVDGVEATTGPL
GQGLGMAVGMALAERQLAAQFSESPQLVDHYTYALVGDGDLMEGVSHEAASFAGNQQLQK
LIVLYDDNAVSLDGPTSRSFRTDVNQRFASYGWDTQTVGDGNDLTAINAAIERAKHSSRP
SLIAVKTTIGFGAPQAGTNAVHGNPLGTAGLTSLRQQLGWQAAPFTVMPAVAKRAQQLIL
QRGQRAHRRWQSQREALPQAVQHRFEQQVSMRLPVDLATSLPIFDEGAQASRITSHTVIQ
KLAAQLPGLVGGAADLASSNKTTIEQDQLSTPVTPDQRNVAFGVREFGMGTILNGMTLHG
GLRVFGGTFLVFSDYTRAAIRLAAMMKLPVTYVFTHDSIAVGEDGPTHQPIEQLMSLRLI
PNLTVIRPADPNETVAAWWQAINATDHPTVLVLTRQNLAVLSGSKTKAMTGVARGGYVLS
PQRGRQPMGILIASGSEVALALQAQAKLATLGEDVSVVSMPSMENFARQSTNYQAQVLPP
QIRRRVAVEMGATSGWERYVGLDGAVLGLDHFGASGAADQVLAANQFTVADLVRTYQQTH
VDLGQQLRVI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcatttgatgaaattgatgaattagcggtgaataatctacgagtactgagtgcg
gaaatgattgaacgggccggttctggtcatccaggattgccactcggcgcggctccaatg
atgtgggtactgtggagccgacaattacgggtcgatccacagcagtctcaatgggctaat
cgcgatcgctttgtcttatcagccggacacgggtcggcgttgttgtacagtctgctacat
gtgagtggcttcaacgtgacaatgggcgagttacaacgttttcgtcaattcggcagtcac
acgccaggccaccctgaactgggaatcgtggatggtgtggaagccacgaccggtccactg
ggacaggggttagggatggcggtgggcatggccctggctgaacggcaactagcggctcag
ttctccgagtcaccgcagttggtggatcactatacttatgcgttagtcggtgatggtgat
ttgatggaaggcgtctcccacgaagccgccagctttgccggtaatcaacaattgcaaaaa
ttaattgtattgtacgacgataacgctgtttcgcttgatggccccaccagccggtcgttt
cgtaccgatgtgaaccagcgcttcgctagttatggttgggatacacaaacggtaggtgat
ggcaatgatttaacggcgattaatgccgccattgagcgtgccaaacacagttcacgtcca
agcctgatcgctgttaaaacgacgattggatttggcgcaccacaagcgggtacgaatgcg
gtgcatggcaatccgttgggaacggccggtttaactagtttgcggcaacaattagggtgg
caagccgcgccatttacggtgatgccggccgttgctaaacgcgcacagcaactaatcttg
caacgtggtcagcgtgcacatcgccggtggcagtcacaacgagaggctttaccacaagcc
gtacaacaccgtttcgaacaacaggtcagtatgcgtctgccagttgacttagccaccagt
ttaccgatctttgatgaaggcgcccaagcttcgcggatcacgagtcataccgtcattcag
aagctagccgctcagttaccaggattagtcgggggcgcggctgatttagccagttcgaat
aaaacgaccattgagcaggatcaattgtcgactccggtgaccccggatcagcgcaacgtt
gcctttggtgtccgggaatttggtatgggcaccattttgaatgggatgactttacacggt
ggcttgcgggtctttggtggcaccttccttgtcttttccgattacacgcgtgcggctatt
cgattggcggcgatgatgaagttaccagtcacttacgttttcacgcatgactcgattgca
gtcggcgaggacggtccgactcatcagccaattgaacagctaatgagtttacgattgatt
ccgaatctaacggtgatccggcccgctgacccgaatgaaacggtcgcagcttggtggcaa
gccatcaacgcgacggatcatccaaccgtgctcgtcttgacccgtcagaatttggcagtg
ctatccggatctaagactaaggccatgactggtgtggctcgtggcggttatgttctctca
ccgcagcgtggccgccagccaatgggaatcttgattgcaagcgggtcagaagttgcttta
gctcttcaggcccaggcgaaactagctacgttaggtgaagatgtcagtgtcgtttcaatg
ccgtcgatggaaaactttgcgcgccaatcaacgaattaccaagctcaggtcttgccacct
caaattcggcggcgagttgcagtcgaaatgggcgcaacatctggctgggaacgttacgtt
gggttagatggggcggtactaggcttggaccactttggcgccagtggagcggccgaccaa
gtattagccgctaaccagttcacggtagcagacctagtgcggacgtatcaacaaacgcac
gtggatcttggtcaacaattgcgagtcatttag

DBGET integrated database retrieval system