KEGG   Lactobacillus plantarum B21: SH83_08125Help
Entry
SH83_08125        CDS       T03680                                 

Definition
(GenBank) ABC transporter permease
  KO
K01992  ABC-2 type transport system permease protein
Organism
lpb  Lactobacillus plantarum B21
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpb02000]
    SH83_08125
Transporters [BR:lpb02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    SH83_08125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_4
Motif
Other DBs
NCBI-ProteinID: AJO74309
UniProt: A0A151G9A4
LinkDB All DBs
Position
1762850..1763602
Genome map
AA seq 250 aa AA seqDB search
MFTLLRQENRKLMHHRVIQLFIPFIMIFQFIIAIYAAHYPQLLTPYDAFVNNDYGFIPLL
FLAITIGSTYLTNERQNGTLRALLYRSYSRTQVLVSKWLTILGLMIGLSGFSTLMSLGLK
LSFFRRLPNYGTIWHTWGLNMLSTGLTLLFLMSVVLLLGTLFTSSTPAILTGIIGYFIVT
IFNQLCFYLYAKVSWLKWNPLNMINLGEQIQTPQLQQLTRLNLSTLAIGYIAYLLLFLTL
ANYSFQTRNV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgttcacattgttacgacaagaaaatcgaaaattaatgcaccatcgtgtgattcaactg
tttattccatttataatgatttttcaattcataattgcaatatatgccgctcactaccca
cagctactaacgccatatgatgcatttgtaaacaacgactacggctttattccgctacta
tttttggcaatcacaattggcagcacttatttaacgaatgaacggcaaaatggcacgtta
cgagcgctactttatcgcagttattcgaggacccaagtcttagtcagcaaatggctcacg
atactcggtctgatgattggcttatctggctttagcaccctcatgagtctcggactgaag
ttgagcttctttcggcggttacctaattacggtacaatttggcacacttggggtctgaac
atgctatcaacaggactgaccctactatttttaatgagtgtcgtcttactattgggcacc
ctattcaccagttcaacaccagccattctgaccggcatcattgggtactttattgtgacc
attttcaatcaactttgtttttatttatacgccaaagtcagctggttaaagtggaatccg
ctcaacatgatcaatctaggcgagcaaatccaaacaccacaactacaacaattaacccga
ctaaatctatccacgctggcgattggttatatcgcctatctactgttattcttaacgctt
gccaactattcttttcaaacccgtaacgtttaa

DBGET integrated database retrieval system