KEGG   Lactobacillus plantarum B21: SH83_10200Help
Entry
SH83_10200        CDS       T03680                                 

Definition
(GenBank) UDP-N-acetylmuramyl peptide synthase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00550  Peptidoglycan biosynthesis
lpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SH83_10200
Enzymes [BR:lpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     SH83_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M zinc_ribbon_10 Zn_Tnp_IS1595 NOB1_Zn_bind OrfB_Zn_ribbon zf-TFIIB Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AJO74679
UniProt: A0A0G9F812
LinkDB All DBs
Position
2173062..2174408
Genome map
AA seq 448 aa AA seqDB search
MSINSTLATWTGKSAYWFLHTFRGGGSSLPGKLALKLDPTILKHLAKNYDVIVITGTNGK
TLTTALTVKVLREQYPDILTNPSGSNMKQGIVTTFLRAPKAHQKPLAVLEVDEANVIMVT
KYITPKAFVFTNIFRDQMDRYGEIYTTYQKILDGVALAPEATIIANGDLPLFNAKQLPNP
ILYYGFDYQPDHDQQAPANTDGLLCPRCQHILRYHSRTYSNMGKYYCPHCGFERPQLTYK
LNALTAMTPTSSDFEINGQAMHLNIGGQYNIYNALAAYAVGRFMDVTPAKIAHALSDNDE
QVFGRQETFHVGEKDVTLILVKNPVGLNQVLQTISTDDRPFSFAALLNANYADGIDTSWI
WDGNFEKLPALNIPAYISGGERYRDITFRLKVAGVPEDQLTIIPDLTNMTTAIQKLPTKQ
VYVVATYTAMLQLRKQLASQGIIDGGMA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaatagtacattagccacctggacgggtaaatccgcatattggtttttacac
accttccgtggcggtgggagctcactccccggcaagttagcgctgaagctcgatccaacg
attttaaagcatctcgctaaaaactacgacgtcatcgtcatcactgggaccaacggtaaa
acgttaacgaccgccttgacggtcaaggttttacgtgaacagtaccctgacattttaacc
aatccaagtggatccaacatgaagcaaggtatcgtcacgacctttttacgggcacctaaa
gcgcaccaaaagccactcgcagttctagaagtcgacgaagctaacgtaatcatggtcacc
aagtacatcacgccaaaagcctttgtcttcacgaacattttccgtgaccagatggatcga
tatggtgaaatctacacgacatatcaaaaaatcttagacggggttgctttagcacctgaa
gcgacaattattgccaacggtgatttgccactcttcaatgccaaacaattgcctaatccg
atactgtattacggatttgactaccagcccgaccatgaccaacaagcgccagcaaatacg
gatggcctgctttgtccgcgttgtcagcatattttacgttaccatagtcgaacttatagc
aatatgggcaagtattattgtccccactgcggttttgagcgtccacagttgacatacaaa
ttaaacgccctaaccgctatgacaccgactagctcagactttgaaatcaacggtcaggcc
atgcatcttaatatcggtggtcaatacaatatttataatgcgctagctgcctacgcggtt
gggcgcttcatggacgtcacgccggccaaaatcgcgcacgcccttagcgacaacgatgaa
caagtctttggtcgtcaagagacctttcacgttggcgaaaaggacgtcacgctgattctc
gtcaagaatccagtgggccttaaccaagtcttgcaaacaatcagcaccgatgaccggcca
ttctcatttgccgctctgctcaacgcaaactatgcagatggtattgatactagttggatc
tgggatggtaattttgaaaaattaccggcattgaatattcccgcctatattagtggcggt
gaacgttatcgtgatatcacgttccggctaaaagttgctggggtaccagaagatcagtta
accattattcctgacctgaccaacatgacgaccgcaattcaaaaactaccgaccaagcaa
gtctacgtcgtcgcaacttacaccgcgatgttgcaattacgaaaacaacttgctagtcaa
ggcattatcgatggggggatggcttaa

DBGET integrated database retrieval system