KEGG   Lactobacillus plantarum B21: SH83_14150Help
Entry
SH83_14150        CDS       T03680                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lpb  Lactobacillus plantarum B21
Pathway
lpb00250  Alanine, aspartate and glutamate metabolism
lpb00410  beta-Alanine metabolism
lpb00430  Taurine and hypotaurine metabolism
lpb00650  Butanoate metabolism
lpb01100  Metabolic pathways
lpb01110  Biosynthesis of secondary metabolites
lpb01120  Microbial metabolism in diverse environments
lpb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SH83_14150
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SH83_14150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SH83_14150
   00430 Taurine and hypotaurine metabolism
    SH83_14150
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SH83_14150
Enzymes [BR:lpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SH83_14150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJO75735
LinkDB All DBs
Position
3017635..3019038
Genome map
AA seq 467 aa AA seqDB search
MLYGKHNHEAEEYLEPVFGAPSEQHDLPKYRLPKHSLSPREADRLVRDELLDEGNSRLNL
ATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPDDEHFTGTS
TIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAHRPNLVISAGYQVCWEKFCVYWDVDMHV
VPMDEQHMALDVNHVLDYVDEYTIGIVGIMGITYTGQYDDLAALDKVVTHYNHQHPKLPV
YIHVDAASGGFYTPFIEPQLIWDFRLANVVSINASGHKYGLVYPGVGWVVWRDRQFLPPE
LVFKVSYLGGELPTMAINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLAAALD
KVGEFKMINNGHQLPLICYQLAPREDREWTLYDLSDRLLMNGWQVPTYPLPANLEQQVIQ
RIVVRADFGMNMAHDFMDDLTKAVHDLNHAHIVYHHDAAPKKYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggtaaacacaatcatgaagctgaagaatacttggaaccagtctttggtgcg
ccttctgaacaacatgatcttcctaagtatcggttaccaaagcattcattatcccctcga
gaagccgatcgcttagttcgtgatgaattattagatgaaggcaattcacgactgaacctg
gcaactttttgtcagacctatatggaacccgaagccgttgaattgatgaaggatacgctg
gctaagaatgccatcgacaaatctgagtacccccgcacggccgagattgaaaatcggtgt
gtgaacattattgccaatctgtggcacgcacctgatgacgaacactttacgggtacctct
acgattggctcctctgaagcttgtatgttaggcggtttagcaatgaaattcgcctggcgt
aaacgcgctcaagcggcaggtttagatctgaatgcccatcgacctaacctcgttatttcg
gctggctatcaagtttgctgggaaaagttttgtgtctactgggacgttgacatgcacgtg
gtcccaatggatgagcaacacatggcccttgacgttaaccacgtcttagactacgtggac
gaatacacaattggtatcgtcggtatcatgggcatcacttataccggtcaatatgacgac
ctagccgcactcgataaggtcgttactcactacaatcatcagcatcccaaattaccagtc
tacattcacgttgacgcagcgtcaggtggcttctataccccatttattgagccgcaactc
atctgggacttccggttggctaacgtcgtttcgatcaacgcctccgggcacaagtacggt
ttagtttatcccggggtcggctgggtcgtttggcgtgatcgtcagtttttaccgccagaa
ttagtcttcaaagttagttatttaggtggggagttgccgacaatggcgatcaacttctca
catagtgcagcccagctcattggacaatactataatttcattcgctttggtatggacggt
taccgcgagattcaaacaaagactcacgatgttgcccgctacctggcagccgctctggat
aaagttggtgagtttaagatgatcaataacggacaccaactccccctgatttgttaccaa
ctagccccgcgcgaagatcgtgaatggaccctttatgatttatcggatcgcctattaatg
aacggttggcaagtaccaacgtatcctttacctgctaatctggaacaacaagtcatccaa
cgaatcgtcgttcgggctgactttggcatgaatatggcccacgatttcatggatgacctg
accaaggctgtccatgacttaaaccacgcccacattgtctatcatcatgacgcggcacct
aagaaatacggattcacacactga

DBGET integrated database retrieval system