KEGG   Legionella pneumophila Corby: LPC_0529Help
Entry
LPC_0529          CDS       T00532                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00473  D-Alanine metabolism
lpc00550  Peptidoglycan biosynthesis
lpc01100  Metabolic pathways
lpc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LPC_0529 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPC_0529 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LPC_0529 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpc01011]
    LPC_0529 (ddlA)
Enzymes [BR:lpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LPC_0529 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lpc01011]
 Precursor biosynthesis
  Amino acid ligase
   LPC_0529 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABQ54514
UniProt: A5IAW4
LinkDB All DBs
Position
complement(3124523..3125617)
Genome map
AA seq 364 aa AA seqDB search
MSKPVNLVLLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSGRFHRHDYNDLLA
CSDKLPVVTEKSTPLEGLLINGRLAVDAEIVFPVVHGPLYEDGCLQGLLELAGVAYVGCD
VLSSAIGMDKDMARRLACINGLKSARYKLLSWHANASERQQFCHEVASEFGWPLFVKPCS
LGSSVGIHKANNMDELNAAVADALRYDEEILVEEFIVGREIELAVLENSIPCGKPRVSMV
GEIKVNHPDGYYSYTAKYLESSQTDLIIPAQLNNSLEEQLKQAAANIFSYLKCKGMARVD
FFVNDKTEEIYFNEINTLPGFTSISMYPKLWQATGVAYPDLLDELINLAMVHHNCRQHLV
TNYL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacccgttaatttggttttactttatggtggaaaatcaggcgagcatgaagtg
tcactggtttctgccgcatcggttctaaaacacctggattccgagaaatatcatattata
cccattgcaatggacaaaagcggtcgatttcatcgtcatgattataatgatttgctcgcc
tgttctgataaattacctgttgttactgaaaaatcaaccccgttggaaggcttattaatt
aatggacgtctggcagttgatgctgaaattgtttttccagtggttcatggccctttatat
gaggacggatgtttacaaggtttacttgagttagccggtgtcgcctatgtaggatgtgac
gtattgtcttctgcaatcggaatggacaaagacatggcgaggcgactcgcatgcattaat
gggctcaaatcagcaagatataaattattatcatggcatgccaatgcgtctgaaagacaa
caattttgtcatgaagttgcctcggagtttggttggcctctgttcgttaaaccatgctca
ctaggttccagtgtgggaattcacaaagcaaataatatggatgagctaaacgcagcagtt
gctgatgcattacgctatgatgaagaaattctggttgaagaatttattgtcggaagggaa
attgagctggcagtgttggagaacagtattccctgtgggaaaccaagagtaagtatggtg
ggtgagataaaagtaaaccaccctgacggttattattcttatactgcgaaatatttggaa
agcagtcaaacggatttgattattccagctcaattaaataatagtctggaagaacaatta
aaacaggctgcagcgaatatttttagttatcttaaatgcaaaggcatggctagggtagat
ttttttgtaaatgataagacagaagaaatttactttaatgaaataaatacattacctgga
tttacctccataagtatgtaccccaaattgtggcaggcaactggtgtagcttatcctgat
ttacttgatgaattgattaatctggcaatggttcatcataattgtcgtcaacatttggtg
acaaattacttgtga

DBGET integrated database retrieval system