KEGG   Legionella pneumophila Corby: LPC_1177Help
Entry
LPC_1177          CDS       T00532                                 

Gene name
gatA
Definition
(GenBank) glutamyl/tRNA (Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00970  Aminoacyl-tRNA biosynthesis
lpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LPC_1177 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpc03029]
    LPC_1177 (gatA)
Enzymes [BR:lpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LPC_1177 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LPC_1177 (gatA)
Mitochondrial biogenesis [BR:lpc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LPC_1177 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABQ55142
UniProt: A5ICP2
LinkDB All DBs
Position
2017289..2018740
Genome map
AA seq 483 aa AA seqDB search
MEHYSLAQLSKALHNREFSSVELTQHCINKIQSNKDLNAFISLDEDQALKEAQSADLVLK
NGEGKPLTGIPMALKDLFCTKRLNTTCASKMLANFQAPYDATIVTKFKQNGAIIIGKTNM
DEFAMGSSNENSYFGSVKNPWDRERVPGGSSGGSAAAVAGNLVPFAIGSDTGGSIRQPAA
FCGISGIKPTYGLVSRYGMVAFASSLDQAGPFAKSAEDLAMILHCIAGFDSKDSTSVDRV
IPDYSAEIKKPVDKIRIGLPSCFFQPQVEKGIQDAIHDAVKLFENLGAEIIEIDLKLQPL
WVPCYYVIACAEASSNLSRYDGIRFGHRSKSASTLIELITNSRSEGFGNEVKRRILTGTH
VLSTGFFNAYYLHAQKVRRLIRDELITTLNSVDVIIGPTTPTTAFKLGEKINDPIQNYLA
DVFTVAANLAGLPAISIPTGFENKLPIGLQLMGKHFSESRLLAIAHHYQQHTNWHLANPN
KQG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaacattactcactggctcaattatcaaaggctcttcataatcgagaattttcaagt
gttgaattaacacaacactgtattaacaaaattcaaagcaataaagacttgaatgcattc
atcagccttgatgaagaccaagctcttaaagaagcgcaatcggctgatttggtactaaaa
aatggagagggaaagccgctgactgggattcccatggctctcaaggatttgttttgtaca
aagcgattaaatacaacttgtgcttcaaaaatgctggctaattttcaagccccctatgat
gccactatcgtcacaaaatttaaacaaaatggcgcaataattattggaaaaaccaatatg
gatgagtttgccatgggatcctctaatgaaaacagttacttcggttcggtaaaaaacccg
tgggatagagaaagagtgccaggtggatcatcaggcggttctgcagcagcggttgctgga
aatctggtaccttttgcaattggctctgacaccggtggatcaattcgtcagccagcagcc
ttttgcgggattagcgggataaaacccacctatggattagtctctcgatacggaatggtc
gcctttgcctcaagccttgatcaagcgggaccatttgcgaagtcagctgaagatctggcc
atgatacttcactgtattgcggggtttgatagtaaagattccacatcagttgatagagtt
atacctgattattcagcagaaattaaaaaaccagtagacaaaatacgcataggacttcct
tcttgcttttttcaacctcaagtcgaaaaaggtatccaggatgccatacatgatgctgtg
aaattatttgagaatcttggggctgaaataattgaaatcgacttgaaacttcagccactt
tgggtgccatgttactatgttatagcttgcgcagaagcttcatcaaatctttcgcgttat
gatggcataagatttggccaccgaagcaaatccgcatcaaccttaatcgaattaatcact
aactctcgaagtgaaggttttggtaacgaagtaaaacgtcgaattctaactggaactcat
gtgctctcaaccggtttttttaatgcctattatttgcatgcacaaaaagtgaggcgtttg
attcgagatgagttaattacaactttaaattcagtagatgttatcattgggccaacgacc
cctaccaccgcttttaaattgggtgaaaaaataaatgatcccatacaaaattatttggca
gatgtatttactgtagcagccaatcttgcaggcctaccagctatttctataccaactggt
tttgaaaataaactaccaattggtttgcaattaatgggtaagcactttagtgaaagccgc
ttgcttgcaatcgcacatcattatcagcaacacaccaactggcatttagccaatcctaac
aagcaagggtga

DBGET integrated database retrieval system