KEGG   Legionella pneumophila Corby: LPC_1188Help
Entry
LPC_1188          CDS       T00532                                 

Gene name
suhB
Definition
(GenBank) inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00521  Streptomycin biosynthesis
lpc00562  Inositol phosphate metabolism
lpc01100  Metabolic pathways
lpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LPC_1188 (suhB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LPC_1188 (suhB)
Enzymes [BR:lpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     LPC_1188 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P EFG_IV FBPase
Motif
Other DBs
NCBI-ProteinID: ABQ55153
LinkDB All DBs
Position
2029183..2029968
Genome map
AA seq 261 aa AA seqDB search
MEPLLNIAVNAARQAGEIINRYVEQVDRLKITPKNSHEYFSEVDIKAEQVIINTIHKAYP
EHGILAEESGIQQSDSDTVWIIDPLDGTSNYLHGFPFYSVSIALKIKNRLEHGVIYDPLR
HECFAASRGRGARLNDRRIRVSKQTQLNASLLGTGFHFRDATLAQRYLPTFEALIGKCAG
VRRTGSAALDLAYVASGRLDGFWEFGLRPWDIAAGALLVREAGGLISDVQGGEDFLNYGD
VVAGTPKVFKSLLQTISPVLK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaaccacttttaaatattgctgtcaatgctgcgcgacaggctggtgaaatcattaat
cgttatgtagagcaagttgatcgtttaaaaataactcccaaaaacagccatgaatatttt
agtgaagtggacattaaagcggagcaagttatcattaatacgatacataaagcctatcca
gagcatggaattcttgctgaagaaagcggcattcagcaaagcgatagtgatacagtctgg
atcattgatccattggatggcacctcaaattatcttcatggattccctttttattctgta
tccatagccctgaaaattaaaaatcgtctggagcatggtgttatttacgatcccctgcga
catgagtgttttgctgcaagcagagggcgcggggcaaggctaaacgatagaagaatccgt
gtgtccaagcaaactcaactcaatgcctctctgttaggcacaggttttcattttcgagat
gcaactcttgcccagcgatatttaccaacctttgaagcattgattggaaaatgcgctgga
gttagaagaacaggttctgctgctctcgacttggcttatgttgcaagcggtcgtctggat
ggcttctgggagtttgggttacgcccgtgggatattgctgcgggagctctgctggttcga
gaggccggaggattaataagtgatgtccagggtggagaagatttcctaaattatggcgac
gtagtagcaggaactcctaaagtatttaagtcacttttgcaaaccatatcacccgtttta
aaataa

DBGET integrated database retrieval system