KEGG   Legionella pneumophila Corby: LPC_1987Help
Entry
LPC_1987          CDS       T00532                                 

Gene name
lepB
Definition
(GenBank) effector protein B, substrate of the Dot/Icm secretion system
  KO
K15492  effector protein B
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    LPC_1987 (lepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LepB_N LepB_GAP_N LepB_GAP_C Fib_alpha
Motif
Other DBs
NCBI-ProteinID: ABQ55917
LinkDB All DBs
Structure
PDB: 

Position
2980905..2984789
Genome map
AA seq 1294 aa AA seqDB search
MLTYQGKEIVRFKEKTGGKNKSDVDGFYEDSDGRKFFIKKPGDPRELFTELFAGLLLKEF
MKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKIIGTSYGDGSDRNTIKETF
FGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLKGEGEEKSKQFGRIDWGDA
FRYFAHPNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPE
LLIDIVTGALKNIPTDLIEEKTKIQLAAYMCMDSLKEATFGPEGNCKSFAIAMAALLENR
LGKIAVLKDMSPLSNPEELYQSILELKYMTLPMTSSTSFSETINQWTNILKTSDMEKFSF
DSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFV
PYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINT
LKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADVKESLKAPTFAEPLPDKESEFFYP
IDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDP
AGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIQKQTIEFEELEATLIQIKEKY
QLQEKMAEQSEHEKSSAQSIIRSLNLELSQLKLQLQEQEKLQFQLKELKEKIHEQTTLSK
RLGEKLQTQKKTNTHQEETIQRITKEKSLADSSLESLRKELHELAKKESSLHKTLEEKQL
QVQQLEEQLAEKEKENLVLKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQEALQLQ
LKSLSEQVQEQTLLVESLKEELQKQKESNTHQEETIERITKEKSLANSALESLRKEMHEL
TRKNEENQLKLLKQVHSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKEKASEKRTVVSL
REQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIEDQKRQLEELKIKIQELA
SANQELGKQNQSLSKENLHNKNTVEDLKKKLNELSVQLEQLHQSSSEKEQTIRKLREELI
KKDSSLKQNEEMQLVQKHLQEEIDRLQKEIKQQQLNVNQLQSLIAQSKEAEKRYQQALQQ
KKGIYFARMERVSPIYWQIQQIEQKAKELEERRETEASTAAKTLATKLRLEIKNYLDNSE
FDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKAT
TGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atgttaacttatcaaggtaaagaaatagttcgatttaaagaaaaaacaggtggtaaaaat
aaaagtgatgtcgatggtttttacgaagacagtgatggacgaaaattttttataaaaaaa
ccgggcgaccctcgtgagctattcacggaattatttgcaggcttgctattaaaagagttc
atgaagcgaggattgattgatgaaagctattttccatcattgatttgcgccgatgtcatt
caatttgaagacaagtcctatggactgatacagccactggtttcatttgatgaattacac
aaaatcattggaacgagctacggtgatggcagtgatcgtaatacgataaaggaaaccttc
tttgggccaggctattatgccgggatcacaaaacaaaataaatattttggcctttctatg
gcccttatgttttctctattgctgggagcccatagtgtacatagtggcaatatcgttgta
ctcaaaggagaaggagaagaaaaaagcaaacaatttggccgaatcgattggggagatgcc
ttccgttatttcgctcatccaaacaataatgacaatctcctttatgcttatgaaaacaga
ggttggtttaattataaatcactaactaaagattatttcctgaactataagaagatcaat
gggctcttccctgcaatggctgaaaaagcccggcaattacaatccaagctaaatcctgaa
ttgcttattgacatagtaactggtgcactcaaaaacattccaaccgatctgatagaagaa
aaaaccaaaatccaacttgctgcctacatgtgtatggattcattaaaagaggcgacattt
ggcccggaggggaattgcaaatcttttgcgattgccatggccgcattattagaaaatcgt
ttaggaaaaattgctgttcttaaagatatgtccccattgagcaatcctgaagaactgtat
caaagtattttggaattaaaatacatgacgcttcctatgacctcttcaacctctttttca
gaaaccataaatcaatggacaaacatcttaaaaacttcagacatggaaaaattttcgttt
gatagtaatccaatcaacctactggaattagtcaaacaatttaatctttacgttgatgaa
ctagctatcacgtgtgaagccaataatgtctgggcaaaagaaagaatagacagcacccct
aatctgtttgctctctacgataatagtggtggtgaagcgattcacggacatgcctttgtt
ccttactacaaagaaagcattgtattgcgccgcctatttacagtagaccctaatactttc
aacttatctcgttttgccgcttttgaaggaccatgtcaactctattgcaaggaacataaa
gactctgcctgggttaaaatccaaaccttactgactttaggtaatggaattattaatacg
ctaaaaataatcaaacaggctcaagcattcggaatagatgaggcagttacagagaattta
aaagcattgaaagaacaattcattgcttttcaacttgcagaagctgatgtaaaggaatca
ttaaaagcacctacttttgcagagcccttgcctgataaggaaagtgagtttttttatccc
attgatgaaaaagcattagctaaaatgaatggatatcaacttgcaacgatttgtctggag
gaactaaatagccctaaaccgtcgcctttaattgaaagaattctcagtaataaaaaattt
tggaaacgtataaactctgcttttgaaagtggtgtatttaaaggccgcacagatgatccc
gccggaaaaatagctaaaatccgtgaatggcatcaattattacagatttctggtaaaaaa
actgctggacaaattgatgagctgcaaaagatagtaatttctcttcaatcaaaaattcaa
aagcaaacgattgaatttgaggagttagaagcgactttaatccaaataaaggaaaaatat
cagttacaagagaagatggctgagcaaagtgaacatgagaaatcttctgcccaatccatt
attcgctctctgaatttagaactgagtcagcttaaattacaactgcaagagcaagaaaaa
ttacagttccagttaaaagaactcaaagagaaaatacatgaacaaacgactctatccaag
cgattaggagagaagctgcaaacgcaaaagaaaaccaacacgcaccaggaagaaaccatt
caaagaatcaccaaagaaaaatcattggccgattcttcccttgagtcgcttcgaaaagag
ctgcatgaattggcaaaaaaagaaagctctcttcataaaacgctcgaagaaaaacaatta
caagtacaacagttagaagagcaattagcagagaaagaaaaggaaaatctagtcctgaaa
aaagctgacaaacaaagtcaacatgaaaaatccctggataaatctgctattgaatctcta
acctcagagcttaatcagcttaaattagaactgcaaaaacaagaagcattacaattgcag
ttaaaatctttaagcgaacaagttcaagagcaaacattacttgtagagagcttgaaagag
gagttacaaaaacaaaaggaaagcaacacacaccaggaagaaactattgaaagaatcact
aaagaaaaatcattggccaattctgctcttgaatcgcttcgaaaagagatgcatgaatta
actcgaaaaaacgaagaaaatcaacttaaactattaaaacaagtccactctcttagcgaa
caacttgaagaaaaacaattacaaattagagaatttgagaagcaattacaagaaaaagaa
aaaagagttgagcaaagtgagaaagagaaagcttccgaaaaacgaactgtggtttcactt
agggagcaagtaagcaatttaaaattgcaattacagcaacttggagaggtaatccaggaa
aaggaaaaaggctcctctttgataagccagcaatccaaacaaattattgctcttcaagag
attatagaagatcaaaaaagacaattggaagaattgaaaataaaaattcaggaacttgca
tctgcaaatcaagagcttggaaaacaaaatcaaagtttgagcaaggaaaatttacataat
aaaaatacagttgaagatcttaagaaaaaattgaatgaattaagtgttcaattggaacaa
ttgcatcaatcttcaagtgaaaaagaacaaaccattagaaaattgagagaagaactcatt
aaaaaagattcttcgctcaaacagaatgaggaaatgcaattagttcaaaaacatctgcaa
gaggaaattgatcgtttacaaaaagaaattaaacaacagcaattaaatgtaaatcaatta
cagtctttaattgctcagagtaaggaagctgaaaaacgctatcagcaagctttacaacag
aaaaagggaatttactttgcgcgaatggaaagagtgtctcctatttattggcaaatacag
caaattgaacaaaaggccaaagaattagaggaaagaagagaaacagaagcatcaacagcg
gcaaaaacactcgcaacaaaacttcgtttagagataaagaattatctcgacaatagtgag
ttcgatgaaaaaagtgccttaaactcattcaaaataaatgccaaacggcatatagaaaac
tcgaaggaaacgctaaatcaacatcgcgaagaatggaagtacctgttagccaatgttact
ttaggggtattcttgcttggaatcggttatctcgccgctattttgattaacaaagcaact
actggcaattatacctttttcagccaaactaacagcgggaaaaaattggacgcgttggaa
aaagcgatttcttccactcactccgaaacattagtttatggataa

DBGET integrated database retrieval system