KEGG   Legionella pneumophila Corby: LPC_2282
Entry
LPC_2282          CDS       T00532                                 

Definition
(GenBank) hypothetical protein
Organism
lpc  Legionella pneumophila Corby
SSDB
Motif
Pfam: Plasmid_RAQPRD Uteroglobin
Other DBs
NCBI-ProteinID: ABQ56205
LinkDB
Position
complement(1202545..1202871)
AA seq 108 aa
MKRILCLILMIISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQITPNARIQLQIEG
FEDLQGQHHAGLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
NT seq 327 nt   +upstreamnt  +downstreamnt
atgaaacgaatattatgcctgatcttaatgataataagcctgcaatgctcagcgaataac
cctgatttaaatgaaacgctggtacggattattaatcagattaacgccatcatgcctttg
cttgatgaagcgcaaacacaaataacacctaacgctcgtatccaattgcaaatagaggga
tttgaagatctgcaaggacaacatcacgcaggattgagagaggatttgctaaacatccgc
aacggtctgattgactatatcaaccagcccatcattgcccctcgaaaaattaaaccatta
gaaatggattttgtgaggaaaccctaa

DBGET integrated database retrieval system