KEGG   Legionella pneumophila Corby: LPC_2358Help
Entry
LPC_2358          CDS       T00532                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpc01100  Metabolic pathways
lpc01110  Biosynthesis of secondary metabolites
lpc01130  Biosynthesis of antibiotics
lpc01230  Biosynthesis of amino acids
Module
lpc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPC_2358 (aroK)
Enzymes [BR:lpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     LPC_2358 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA ABC_tran dNK AAA_17 AAA_16 TsaE RuvB_N APS_kinase His_biosynth Ploopntkinase3 AAA_22 AAA_29 AAA_24 AAA_28 IstB_IS21 RNA_helicase Guanylate_kin AAA_5 PduV-EutP Rad17 Mg_chelatase RsgA_GTPase DUF815 AAA_7
Motif
Other DBs
NCBI-ProteinID: ABQ56280
UniProt: A5IFY0
LinkDB All DBs
Position
1114698..1115225
Genome map
AA seq 175 aa AA seqDB search
MSIVKVRNIFLIGPMGAGKSTIGRALAKELKLEFYDSDEVIEERAGADISWIFDIEGEEG
FRRREQKVIDELTQKTNIVLATGGGVVITPENRNALAGRGTVIYLKTSLQQQFERTKRDT
KRPLLQTEDLEGRLESLRDEREPFYDELADVSFETDKLTVKAVANNIIKYLYGEV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagttaaagtacgaaatatttttctcattggtccgatgggtgctggtaaaagt
actataggacgtgctttggcaaaggagctcaaactagaattctatgactcagatgaagta
attgaagagcgtgcgggcgcagatatatcgtggatctttgatatagaaggtgaggaggga
tttagacgtcgagagcaaaaggtcattgatgaattgactcaaaaaaccaatatagtattg
gcaacgggtggcggagtcgttattactcctgaaaacaggaatgccctggcaggccgtggc
acagtgatttatctcaaaacatctttgcaacagcaatttgaaagaacaaagcgtgatacc
aaacgtcctttattacaaacagaagatcttgagggacgcctggagtcactcagagatgag
cgagaacctttttatgacgaattggcagatgtcagttttgaaacagataaactgactgta
aaagctgttgcaaacaatataataaaatacttatatggcgaagtttga

DBGET integrated database retrieval system