KEGG   Legionella pneumophila Corby: LPC_2366Help
Entry
LPC_2366          CDS       T00532                                 

Gene name
ponA
Definition
(GenBank) penicillin binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00550  Peptidoglycan biosynthesis
lpc01100  Metabolic pathways
lpc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lpc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPC_2366 (ponA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LPC_2366 (ponA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lpc01003]
    LPC_2366 (ponA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpc01011]
    LPC_2366 (ponA)
Enzymes [BR:lpc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LPC_2366 (ponA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPC_2366 (ponA)
Glycosyltransferases [BR:lpc01003]
 Polysaccharide
  Bacterial polysaccharide
   LPC_2366 (ponA)
Peptidoglycan biosynthesis and degradation proteins [BR:lpc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   LPC_2366 (ponA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ABQ56288
LinkDB All DBs
Position
complement(1105381..1107765)
Genome map
AA seq 794 aa AA seqDB search
MKKMAYFWRKGLWALMSLFFLLIVAGSLLYLYLESQLPNVDSLKTVQLQVPLQIFSKEGL
LIQEYGEKKRIPVTYDEIPPTLIHALIATEDQRFFEHPGVDVMGLGRAAVSMLKTGTKSQ
GGSTITMQVARNFFLSRKKTFLRKFNEIMLAIKIDRELSKEKILELYLNRVYLGNRAYGV
GAAAMVYFGKSLKDLNLAELAMIAGLPQAPSTQNPIANPLAAKKRRDHVLERLLEEHYIN
EEQYQNAVNQPITAKYHGTNIKVKAPYVAEMIRQSLYDNFGPEAYTKGYKVYTTIDGKLQ
NTANEVVEKNLIAYDHRHGYRGPIANIGEKDSQSPKIRQKYLRQYPELNSLIPAVVTEVR
EKEATAALQNGQIIIIPWEGMSWARPALKRGGWVGKSPTKAQQVVAAGDIIYVHPTEKSW
QLAQIPEAESAMVAMNPKNGAIEVLVGGFNFSKSKFNRATQSSRQPGSSFKPFVYAAALN
NGYNLATLINDAPIVVDDPSQPNLWRPHNVNLKFNGPTRLKQALVQSKNLVSIRILDDIG
IDYTIDFLTRFGFNKKSLPRALSLALGSLSISPMDLTTAYAVFANGGYKVEPYLIDHITD
ADGKILLQAKPSVVCDPCDKDKIDASTLAPRVISEDIAFLMNTALRDVIQHGTGRAARVL
NRQDIAGKTGTTNDQVDAWFAGFNPNLVVTTWIGFDNPKSLHEYAANLALPLWIDFMKVA
LKDKPETELKQPENVIAVRIDPVSGLLAKPNQENGIIEYFRQNEVPSEEDQGPVYNAHND
QQEEELAPVEESLF
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatggcatacttctggcgtaaaggtctttgggcgctgatgagcctgtttttt
ctcctaatagtggctggcagccttctatatctttatctcgaaagccaattgcctaatgtt
gattcattaaaaactgtacaactacaagtgccattacagattttcagcaaagaaggttta
ttaattcaggaatacggtgaaaaaaaacgtattcccgtaacttatgacgaaattccccct
actctgatccatgcattaattgcaacagaagatcaacgattttttgaacaccctggtgta
gacgttatgggattgggccgagctgcagtaagcatgctcaaaactggaaccaaatctcaa
ggtggcagtacgatcaccatgcaagtagctcgtaattttttcttaagccgtaaaaaaaca
tttttacggaaattcaatgaaattatgcttgctatcaaaattgaccgggaattaagtaaa
gaaaagattttggaactttacttaaacagagtttatctgggtaaccgggcttacggtgtt
ggtgcggcagccatggtttattttggaaaatcccttaaagaccttaatctggctgaactg
gctatgatagcaggacttcctcaagctccctcaactcagaatcctatcgctaacccgctt
gctgcaaaaaaacgtcgtgaccatgtactggagcgattactggaagaacattatatcaat
gaagaacaataccaaaatgcagtcaatcaaccaattactgcaaaataccatggaactaat
atcaaggtgaaagcgccttatgttgctgaaatgattcgtcagtccctgtacgacaatttt
ggccccgaagcgtacactaaaggctataaggtatatacaaccattgatggcaaattacaa
aatactgccaatgaagtggtagaaaaaaatctgattgcttacgatcatcgacatggttac
agagggccaattgccaatataggtgaaaaagacagtcaatctcccaagattaggcaaaaa
tacttgcggcaatatccagagctgaacagcctgattccagcagtagtcactgaagtaaga
gaaaaagaagcgactgcggcattacaaaacgggcaaataattattattccctgggagggt
atgtcctgggccaggccggcactgaaaagaggaggctgggttgggaaatcaccgaccaaa
gcacaacaagtggtggcagcaggcgatataatttatgtacaccccacggaaaaatcctgg
caactcgcccaaattcctgaagcagaatctgcaatggttgctatgaatcctaaaaatggc
gccattgaagttttggtcggaggatttaacttctcaaaaagtaaattcaaccgagctacc
caatccagcaggcaaccaggctccagtttcaaaccatttgtttacgctgcggctttgaac
aatggttataatcttgctaccttaattaatgatgcccccatcgttgtagacgatcccagc
caaccgaatttatggcggccacacaatgtgaatctaaaattcaatggccctacccgcctg
aaacaggcattagttcaatctaaaaatttggtatctataagaattcttgatgatataggt
attgattatacgatagatttcttaactcgttttggctttaataaaaaatcattgcctaga
gccttatcacttgctttaggaagtttgtccattagccctatggatttaaccactgcttat
gcagtctttgctaatggtggttataaagtagagccctacctcattgaccatataacagat
gctgatggtaaaattctgttacaagccaaaccaagtgttgtatgtgacccttgtgataaa
gacaaaattgatgcttctaccttggcaccgcgcgttatttctgaagacattgccttttta
atgaatacggcattgcgcgatgtaatacagcatggcactggacgtgctgcacgagtatta
aatcgtcaagacatcgccggtaaaacagggactactaatgatcaagtagatgcgtggttt
gccggatttaaccctaatttggtagtaacaacctggattggttttgataatcccaaatca
ttgcatgaatatgctgcaaatcttgctcttccactatggattgattttatgaaagtagca
ttaaaagacaaacctgaaactgaattgaagcagcctgaaaatgttatagcggttcgaata
gatccagtaagtggtttgcttgctaagcctaaccaggaaaatggcatcattgagtatttt
cgacaaaatgaggttccatctgaagaggatcaaggtcctgtctataatgcacataatgat
cagcaagaagaagagctagcaccagtggaagaaagtctgttttaa

DBGET integrated database retrieval system