KEGG   Legionella pneumophila Corby: LPC_3282Help
Entry
LPC_3282          CDS       T00532                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lpc  Legionella pneumophila Corby
Brite
Enzymes [BR:lpc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LPC_3282 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABQ57169
LinkDB All DBs
Position
3532892..3533470
Genome map
AA seq 192 aa AA seqDB search
MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA
KGGIFNNAAQVWNHTFYWHSMSPNGGGEPKGRLAEAINKSFGSFAAFKEQFSQTAATTFG
SGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIEAFWS
LVNWDFASSNLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaccctgccgcaattaccttatgcattggatgcactggctcctcatgtttcc
aaagaaaccttggaataccattatggtaaacaccataatacttacgttaccaacttaaat
aaattaattcccggaacagaatttgaatccatgactctggaagagatcatcatgaaagct
aaaggcggcatttttaacaatgcggctcaggtttggaatcacaccttttattggcacagc
atgagtcctaatggtggaggcgagccaaaaggcaggctggcggaagccattaataaaagc
tttggttcttttgcagcattcaaagaacaattttcacaaacagctgctacaacattcggt
tccgggtgggcatggttagtccaggatcagtcgggggctttaaaaattatcagcacaagc
aatgctggaacaccaatgactgaaggattaaatgccttattaacttgtgacgtatgggag
cacgcttattacatcgattatagaaataggcgcccggattatattgaagccttttggtca
ttagttaattgggattttgcgagcagtaatctgaaataa

DBGET integrated database retrieval system