KEGG   Lactobacillus paracollinoides: AYR62_06735Help
Entry
AYR62_06735       CDS       T04675                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lpd  Lactobacillus paracollinoides
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lpd01001]
    AYR62_06735
Enzymes [BR:lpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AYR62_06735
Protein kinases [BR:lpd01001]
 Serine/threonine kinases: Other
  Bacterial family
   AYR62_06735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH RIO1 Kinase-like Seadorna_VP7 Haspin_kinase DUF4131 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ANZ63815
LinkDB All DBs
Position
complement(1511595..1513613)
Genome map
AA seq 672 aa AA seqDB search
MRANYTLNGRYRIIRSLGEGGMANVYLAHDLILDRDVSVKLLRLDLRDDPKTIKGFQREG
LAATELVHPNIVSVYDVGEENGMQYLVMEYVKGMDLKAYIQEHFPIPYQEVINIMEQVLS
AVRVAHDHNIIHRDLKPQNILMDENGVAKITDFGIAVALSQNSLTQTNTVLGSVHYLSPE
QARGGMATKQSDIYSLGIILYEMLTGTVPFKGETAVSIAIKHFQSEIPSVRDFDPRIPQA
LENVVLQATSKRPEDRYDTVKSMADDLETSLSPRRASEPKFVPDHDSDNGETKVLDKAAL
QSELAAHKVDETDENGVKVAKPKKKKRHHRKRWWAVLIGLILLLVAGTVFAFWLGRPKYV
SVPDVTGMTETAAKAKLSDKNLTVNKVTHKTSRQIRKGRVIKTNPKAKKSVQTQSNVMLT
LSSGPKLVKIGNYVGQSYTRAASVLRAKGVTVKRQNQTSNDVAVGTVMAQSTTSGTRIDP
DSTTVTFTVSAGQRQLTLANLVGKTKTQIQAYASKESLNVSFNYRYASAKKDRATSQSPA
AGSLVSEGTTIVVTLSRGPKPTTPKIDEFSVTVDIPFEASSDDSSSNATDDSSDSSDTSS
SSSSAVSATNVVQIYLRDQDHNYRSVYKQLTIAQDTQVNLPFAVESGKSGGYKIVRDGKV
ILSDNNVTKNSH
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcaaactatacattaaatgggcgctatcgcatcatccgttctctgggggagggc
ggcatggcaaacgtttatctagcgcacgatctgatcttggaccgggatgtgtccgtgaag
ctattacggctggatcttcgtgatgacccaaaaacgatcaagggttttcagcgtgaagga
cttgcggcaacagagcttgtgcacccaaacattgtcagcgtctatgacgttggcgaggaa
aacggcatgcagtacctggtgatggaatatgtgaaggggatggatcttaaagcctatatt
caagaacattttccgattccttatcaggaagtcatcaacattatggagcaagtgctctcc
gctgtgcgggtagcacatgaccataatattattcatcgggatttaaagcctcaaaacatt
ttgatggatgaaaatggcgtggcgaagatcaccgatttcgggatcgctgttgcgctgtca
caaaattcattgacgcaaaccaacacggtgttaggttctgtccactatctgtcaccggaa
caggcccgcggtgggatggccacaaaacagtctgatatttattctctgggtattattctg
tatgaaatgctgacaggaaccgtaccgtttaagggtgagacggccgtttcaatcgctatc
aaacattttcagtcggagattccatcagtgcgtgactttgatccccgaatcccgcaagca
cttgaaaacgtggtgttgcaggcaacgtcaaaacgtcctgaagaccggtatgacaccgtt
aagagtatggcggatgatttggaaacctcactttcaccacggcgtgccagtgagccaaag
tttgtgccggatcacgactcagataatggcgaaacgaaagtgcttgataaagccgcattg
cagtcggaattagccgctcacaaagtggatgagaccgatgaaaatggggtcaaggttgcc
aaacccaaaaagaagaaacgccatcatcgcaagcggtggtgggccgtccttattggactg
atcctgcttctcgtcgctggaacggtgtttgcgttttggcttggacgaccaaaatatgtt
tctgttccagatgtgactgggatgacagaaacggcggccaaggctaaactgtctgataag
aacttgacggttaataaggtgacacacaaaacgagtcggcagatccgcaagggccgggtc
atcaaaacgaatccgaaagccaagaagtcggttcagacacagagcaatgtgatgctgacg
ttgtccagtggccctaaactggtcaaaatcggtaactacgttgggcagtcctatacgcgt
gcagcgtctgtactgcgggcgaagggcgtcaccgttaaacggcagaaccaaacgtcaaac
gacgtcgcggttggcactgtcatggcgcagagtacaacgtctggcacccgaatcgacccg
gacagcaccacggtgaccttcaccgtttctgcgggtcagcggcaacttacgcttgctaac
ttagttgggaaaacgaagactcaaattcaggcgtatgccagcaaagaatccctgaacgtt
tcctttaactaccgctacgcaagtgcaaagaaggaccgggcaaccagtcagagtccggct
gcaggtagtctggtgagtgaagggacaacgatcgtcgtgaccttgtcacggggaccaaaa
ccgacaacgccgaagatcgacgagttcagtgtgaccgttgatattccatttgaggcttcg
tctgatgattcaagcagcaacgccaccgatgacagttcagattcttccgatacgagcagc
agcagttcaagtgctgtctcagctaccaacgtcgtccagatctatttgcgtgatcaagac
cataactaccgcagcgtctacaaacagttgacgattgcacaagatacgcaggtcaacttg
ccatttgccgttgaatccggcaagagtggtggttataaaatcgttcgcgacgggaaggtt
attttatctgacaataacgtgacgaaaaattctcattaa

DBGET integrated database retrieval system