KEGG   Lactobacillus paracollinoides: AYR62_07275Help
Entry
AYR62_07275       CDS       T04675                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
lpd  Lactobacillus paracollinoides
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AYR62_07275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: ANZ63911
UniProt: A0A1B2J1P3
LinkDB All DBs
Position
1625242..1626675
Genome map
AA seq 477 aa AA seqDB search
MGDRRHKSTLFLRKDIRTDIFKKTGLAKSLNAFSLITMGVGAIVGAGIFITPGIIAAKYT
GPGAMLAFVLAAVVCSLAALCYSEFSSTIPLAGSAYTYIYAVFGEFIAWILGWALVSEYL
FSVSAVAASWSSYFQNILAGFNLYLPAQLRAAFGTAGQPHAIFDLPAFVIIMIVSLLLIG
GIRESARVNAIMVILKIIVIILFIVVGVFYIRPENYHPFLPHGFKGVVSGAAVAFYAYIG
FDAVSTAAEEVKQPQRNVPIGIIGSLLIATALYIALSAVLVGIVKYTKLNVADPVAYALH
FIHQDWVSGIVSLGAVIGMTTVLIVFLYGGTRLVFAISRDGLLPQLFSRLNPKTHAPAVN
TWVFGIVGSIFACIIPIDKITELVNIGTLFAFAMVSIGIVFLRQNPAFKDLDSAFKVPLY
PVLPIVSFILCITLMLELKAFTWIAFFVWLLIGLCVYFSYGYRHSVVRLRYQKDQPK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacagaagacataagtcgaccctgttcttgcggaaagatattcggacggatatc
ttcaaaaaaacggggttggctaaatcattgaatgcatttagtttaattaccatgggtgtt
ggcgccatcgtcggggccgggatctttattacaccaggcattatcgctgctaaatatact
ggtccgggggccatgctagcctttgtcctcgcggcagtcgtgtgttcgttagcagcgttg
tgttattccgagttttcctcgacgattccacttgccggcagtgcctatacttacatatac
gctgtgtttggcgaattcattgcctggattctcggctgggcactcgtgtccgaatactta
ttctccgtttcagcggtcgcggcgagctggtcgtcgtatttccaaaatattcttgccggg
tttaacctctacttaccagcacaattacgagcagcattcggaacagccggtcaaccgcac
gcgattttcgacctgccagcgtttgtaatcatcatgatcgtgtccttgttgctgatcggt
ggtatccgtgaatccgcccgagttaacgcgatcatggtcattttaaagattattgtcatt
atcctattcattgtggtcggcgtcttctacattcgccctgaaaactaccaccccttctta
ccacacggattcaagggcgttgtttcaggggcggcggttgcgttttatgcctacatcggg
ttcgatgccgtctcaacagcggccgaggaagtaaagcagccgcaacggaacgtgccaatt
ggcatcatcggctccctattgattgcgacagccctgtacattgcattgtctgcagttctt
gtcggcatcgtcaagtacacgaagttaaacgttgctgacccggttgcctacgcgctgcac
tttattcaccaagattgggtctctggaattgtttccttaggggcggttattggaatgacc
accgtgctgatcgtctttctctatggcggtacccgattggtctttgcgattagtcgtgac
ggcctgttgccacaattattcagccgtctcaacccaaaaacgcacgcaccagctgtgaat
acttgggtgtttggaatcgtcggcagtatcttcgcctgcattatcccaattgataaaatt
accgaattggtcaacattgggacgttgtttgcctttgcgatggtctcgattgggatcgtc
tttctccgacagaatccggcgtttaaggatctggattcagcctttaaagtcccgctctat
cctgtgttgccgattgtgtcattcatcctatgtatcacactcatgcttgaattgaaggcc
tttacttggatcgccttcttcgtttggttattgatcggtctgtgtgtttactttagttat
gggtatcggcacagtgttgtgcgccttcgttatcagaaagatcaaccaaaataa

DBGET integrated database retrieval system