KEGG   Lactobacillus paracollinoides: AYR62_10745Help
Entry
AYR62_10745       CDS       T04675                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
lpd  Lactobacillus paracollinoides
Pathway
lpd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AYR62_10745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpd02000]
    AYR62_10745
Enzymes [BR:lpd01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     AYR62_10745
Transporters [BR:lpd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    AYR62_10745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 AAA_16 AAA_15 RsgA_GTPase AAA_23 G-alpha AAA_33 Pox_A32 AAA_28 AAA_30 AAA_18 FtsK_SpoIIIE MMR_HSR1 AAA_24 NACHT PRK AAA_25 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ANZ64517
UniProt: A0A1B2IY31
LinkDB All DBs
Position
2375156..2375950
Genome map
AA seq 264 aa AA seqDB search
MQNTDFSQTYLMAPDLPSAITTEDLQVFYGNNHAMHDATLQFPENRITALIGASGSGKST
FLRSLNRMNDDVATVTGKIMYHDTDINAKNVNVYAVRRHIGMVFQRPNPFAKSIRDNITF
ALKAYGIRNQAELDERIETSLKEAALWDEVKDTLDRSALSLSGGQAQRLCLARSLAVQPD
VLLLDEPASALDPISTAKIEATLIKLAEHYTIIIVTHNMQQASRISQYTAFFHLGHVLEF
DTTSNLFQTPQLPITRDYVTGHFG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacacggacttttctcaaacctacctgatggcgccagacctaccatcagcaatc
acgactgaagacctgcaagttttctacggcaacaaccatgccatgcacgacgcgacgtta
cagtttccggaaaatcgtatcaccgcactgatcggcgcctcaggatccggtaaatccaca
tttctcagaagtttaaaccgcatgaacgatgatgtggcaaccgttacgggaaaaattatg
tatcatgacaccgatatcaatgcgaaaaatgtcaacgtttatgcggttcgtcggcacatc
gggatggtgttccaacggccgaatccctttgcgaagtccatccgcgataacatcaccttt
gcgctcaaagcttatggtattcgcaatcaggcggagttagatgaacggatcgaaactagt
ttaaaagaagctgcgctgtgggatgaagtgaaggacacactcgaccggagtgcgttatcg
ctgtctggcggtcaggcacaacgcctctgtctagcgcggtctttggcagttcaaccagac
gttttattgctggatgaacctgccagtgccctcgacccgatttccacggcaaagatcgaa
gccaccttaattaaattggcggaacattacaccatcattatcgtgacccataacatgcag
caggcatcacgcattagtcagtacacggcgtttttccatctgggtcacgtgctggaattt
gataccacaagtaacctatttcaaacgccgcaactgccgatcacccgcgactatgttacc
ggccactttggctag

DBGET integrated database retrieval system