KEGG   Lactobacillus paracollinoides: AYR62_15255Help
Entry
AYR62_15255       CDS       T04675                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lpd  Lactobacillus paracollinoides
Pathway
lpd00250  Alanine, aspartate and glutamate metabolism
lpd00410  beta-Alanine metabolism
lpd00430  Taurine and hypotaurine metabolism
lpd00650  Butanoate metabolism
lpd01100  Metabolic pathways
lpd01110  Biosynthesis of secondary metabolites
lpd01120  Microbial metabolism in diverse environments
lpd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AYR62_15255
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AYR62_15255
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYR62_15255
   00430 Taurine and hypotaurine metabolism
    AYR62_15255
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AYR62_15255
Enzymes [BR:lpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AYR62_15255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANZ65502
UniProt: A0A1B2J211
LinkDB All DBs
Position
complement(3407511..3408911)
Genome map
AA seq 466 aa AA seqDB search
MLYGKPSDDETKYLSPIFGSNAESRDIPKFKLNDTPIEPREAYELVSDELLDEGNSRLNL
ATFCQTYMEPEAEKLMAQSFEKNAIDKSEYPRTADIENRCVNIIADLWHAPKDEAFMGTS
TIGSSEACMLGGMAMKFNWRKNAQKHGLDINAKKPNLVISSGYQVCWEKFCVYWDVELRT
VPMDADHLSLDLNHVMDYVDDYTIGIVGILGITYSGRYDDIAGLDRLVEAHNQKTNFPVY
IHVDAASGGFYTPFMEANLKWDFRLKNVISINASGHKYGLVYPGVGWVLWRDKQFLPEEL
VFKVSYLGGELPTMAINFSHSASQLIGQYYNFIRYGYQGYKAIHTRTHEVAQYLTHALEE
TALFDIVNDGAQLPVICYSQKPDNQHEWTLYDLSDRLLMKGWQVPAYPLPDDLSQTVVQR
IVVRADFGMNMAVDFVQDFNAAIDELNQAHIVFHEDETPKKYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacgggaaaccctcagatgatgaaacgaaataccttagtccgatttttggatcc
aacgcggaaagtcgcgacattccaaaattcaaactcaacgataccccgatcgaaccacgg
gaagcctatgaacttgtttcagacgaactgctcgatgagggcaattcacgacttaatcta
gccacattttgtcagacctatatggaaccagaagccgaaaaactcatggcacagtcgttt
gaaaagaacgccattgataaatcagaatatccacgaacggccgatattgaaaatcggtgt
gtcaacattatcgccgatctctggcacgcaccaaaggatgaagcctttatgggcacttcg
acgattggctcctctgaagcgtgcatgctcggcggcatggccatgaagtttaattggcgt
aaaaatgcgcaaaaacatggcttggacattaacgccaaaaagccgaacttagtcatcagt
tccggctatcaggtctgttgggaaaagttttgcgtctactgggacgtcgagttgcgcact
gtgccaatggacgctgaccacctctcccttgacctcaaccacgtcatggactacgtggac
gactacacgatcggtatcgttggcattcttggcatcacctacagtggccgctacgacgac
attgcgggcttagaccggctggtagaggcgcacaatcaaaagactaattttccagtgtac
atccatgtcgacgcggcctcaggcggcttttacacgccatttatggaagccaatctaaaa
tgggatttccggttaaaaaacgtcatttcaatcaacgcttccggccacaagtatgggctc
gtttatccaggtgtcggttgggtcctgtggcgtgataaacaatttttgccggaggagctg
gtgtttaaagtgagctaccttggcggtgaattaccaactatggccatcaacttctcgcac
agtgcctcccaattaattgggcagtactacaactttattcgctacggctatcagggctac
aaagccattcatacccggacccacgaggtcgctcagtatttgacccacgccctcgaagaa
acggcgttgtttgatatcgtcaacgatggcgcccaattaccagtcatctgttacagccaa
aagcccgataaccagcacgaatggaccctgtatgatctgtctgaccggctgttaatgaag
ggctggcaagtacctgcctatccgctgcctgatgatctctcgcagaccgtggtgcaacgg
atcgttgttcgggcggatttcgggatgaatatggccgttgattttgtgcaggattttaac
gcggctattgatgagctgaatcaggcacatattgtgtttcatgaagatgagacgccgaag
aagtatgggtttacgcattag

DBGET integrated database retrieval system