KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_0938Help
Entry
lp12_0938         CDS       T01726                                 

Definition
(GenBank) penicillin binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00550  Peptidoglycan biosynthesis
lpe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lpe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp12_0938
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    lp12_0938
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpe01011]
    lp12_0938
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lpe03036]
    lp12_0938
Enzymes [BR:lpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     lp12_0938
Peptidoglycan biosynthesis and degradation proteins [BR:lpe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   lp12_0938
Chromosome and associated proteins [BR:lpe03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    lp12_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AEW51207
LinkDB All DBs
Position
1006867..1008528
Genome map
AA seq 553 aa AA seqDB search
MKKTHHFARLVTVAVFFSLILAVLIWRMVDLTVLHRQFLQGQGDARSIRVIDIPAYRGMI
TDRNGTPLAVSTPVESVWVNPKEFSPDEEQFMQLAKYLNLAPKELSRKIVRAENREFVYL
QRQLPPPLSKKIEALKIPGVNFQKEFKRYYPDSDSISPLIGFTNVDDQGLEGIELAYQDW
LMGVVGKKRVIKDRLGRVVEDLGVLKEPRPGHELTLSIDRRLQYLAYSELGKTVEEFSAK
SGSVVVIDAENGEILAVANVPSYNPNARGHYDKETYRNRAFTDTFEPGSVIKSFSIASAL
ETGLFTPDTIIDTNPGWMTVHGRTVRDIHNYGVLDVTGILQHSSNVGVTKMVLSTPAEQL
IGFLQKCGFGQRSELAYPGESEGGIVKAKDANPFVLATLGFGYGLSVTALQLAKANLIFA
NKGRLIPVTLIHNDTPSNGIQVMQPKTAENVLLMMEAVMNKGTGKGARVPGYRVAGKTGT
ARVAGKNGYKDRKYTASFIGIAPVSKPKFVVAVIIHEPSRKGYYAASVAGPLFAKVMSGA
LRLFNIPTDEPVS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacacaccattttgccaggctggttactgtcgctgtttttttctctttgatt
ttggctgttttgatatggagaatggttgatctgactgttctgcatagacaatttttgcag
ggccagggtgatgcgcgcagcatccgagttatagatattcctgcctatcgaggtatgatc
accgatagaaatggtactccgcttgctgtgagcacgcctgttgaatcggtttgggtcaat
ccaaaggaattttctccggatgaagaacaatttatgcagttagctaaatacctgaatttg
gcacctaaagaattaagtagaaaaattgtccgggctgaaaatcgggagtttgtttattta
caaagacagttacctccacccctttcgaaaaagatcgaagctttaaaaatcccaggtgtt
aattttcaaaaagaattcaaacgttattatccagattcggatagtatttccccattaatt
ggatttaccaatgtcgatgatcaaggattggaggggattgagctggcctatcaagattgg
cttatgggagtcgttggtaaaaaaagagtaatcaaagatcgattaggacgagttgtcgaa
gatctgggagttttgaaggaaccacgcccggggcatgagttaactttgagtatagataga
cgactacaatatttagcttatagcgaattaggtaaaacagtcgaagagttttctgcaaaa
tccgggtctgtagttgtaatcgatgctgaaaatggtgagatcctggctgtggctaatgtt
ccatcttataatcctaacgcacgtgggcattatgataaggaaacctaccgcaacagagcc
ttcaccgatactttcgagcctgggtctgtcattaaatcattcagtatcgccagtgctttg
gaaacaggcttatttactccggataccattattgatactaatccaggatggatgactgtt
catggccgaacagtaagagatatccataattatggtgttttagatgttaccggaatatta
caacattccagtaatgtgggtgttacaaaaatggtattatctactccagctgagcaatta
atcgggtttttgcaaaaatgtggttttgggcaacgctctgagttggcatacccgggtgaa
agtgaaggaggcatagtaaaagccaaggatgcaaacccattcgttttagccacattaggt
ttcggttatggcttgtctgttactgcactgcaattggctaaagccaatttaatttttgca
aataaaggacgattaatacctgtgactttgattcacaatgataccccaagtaatggcatt
caagtgatgcagcctaaaaccgctgaaaatgtattattaatgatggaagcggtaatgaat
aagggtacaggtaagggagcaagggttcctggttatagggtagctggaaaaactggaaca
gcacgagttgctggaaagaatggatataaagacaggaaatacacagccagttttattggg
atagcaccagtttccaaaccaaaatttgtagtcgctgttattattcatgaaccttcacga
aagggttattatgctgcctctgtggcaggacccttatttgcgaaagtcatgtcaggtgct
ttacgcttattcaatattcctactgatgagccagttagttaa

DBGET integrated database retrieval system