KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_0954Help
Entry
lp12_0954         CDS       T01726                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01130  Biosynthesis of antibiotics
lpe01230  Biosynthesis of amino acids
Module
lpe_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:lpe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp12_0954
Enzymes [BR:lpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     lp12_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA ABC_tran dNK AAA_17 AAA_16 TsaE RuvB_N APS_kinase His_biosynth Ploopntkinase3 AAA_22 AAA_29 AAA_24 AAA_28 IstB_IS21 RNA_helicase Guanylate_kin AAA_5 PduV-EutP Rad17 Mg_chelatase RsgA_GTPase DUF815 AAA_7
Motif
Other DBs
NCBI-ProteinID: AEW51223
LinkDB All DBs
Position
1026568..1027095
Genome map
AA seq 175 aa AA seqDB search
MSIVKVRNIFLIGPMGAGKSTIGRALAKELKLEFYDSDEVIEERAGADISWIFDIEGEEG
FRRREQKVIDELTQKTNIVLATGGGVVITPENRNALAGRGTVIYLKTSLQQQFERTKRDT
KRPLLQTEDLEGRLESLRDEREPFYDELADVSFETDKLTVKAVANNIIKYLYGEV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagttaaagtacgaaatatttttctcattggtccgatgggtgctggtaaaagt
actataggacgtgctttggcaaaggagctcaaactagaattctatgactcagatgaagta
attgaagagcgtgctggcgcagatatatcgtggatctttgatatagaaggtgaggaagga
tttaggcgccgagagcaaaaggtcattgatgaattgactcaaaaaaccaatatagtattg
gcaacgggtggcggagtcgtgattactcctgaaaacaggaatgccctggcaggccgtggc
acagtgatttatctcaaaacatctttgcaacagcaatttgaaagaacaaagcgcgatacc
aaacgtcctttattacaaacagaagatcttgagggacgcctggagtcactcagagatgag
cgagaacctttttatgacgaattggcagatgtcagttttgaaacagataaactgactgta
aaagctgtagcaaacaatataataaaatacttatatggcgaagtttga

DBGET integrated database retrieval system