KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_2605Help
Entry
lp12_2605         CDS       T01726                                 

Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe00473  D-Alanine metabolism
lpe00550  Peptidoglycan biosynthesis
lpe01100  Metabolic pathways
lpe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    lp12_2605
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp12_2605
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    lp12_2605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpe01011]
    lp12_2605
Enzymes [BR:lpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     lp12_2605
Peptidoglycan biosynthesis and degradation proteins [BR:lpe01011]
 Precursor biosynthesis
  Amino acid ligase
   lp12_2605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEW52847
LinkDB All DBs
Position
complement(2908397..2909503)
Genome map
AA seq 368 aa AA seqDB search
METLMSKPVNLVLLYGGKSGEHEVSLVSAASVLKHLDSEKYHIIPIAMDKSGRFHRHDYN
DLLACSDKLPVVTEKSTPLEGLLINGRLAVDAKIVFPVVHGPLYEDGCLQGLLELAGVAY
VGCDVLSSAIGMDKDMARRLACINGLKSARYKLLSWHANASERQQFCHEVASEFGWPLFV
KPCSLGSSVGIHKANNMDELNAAVADALRYDEEILVEEFIVGREIELAVLENSIPCGKPR
VSMVGEIKVNHPDGYYSYTAKYLESSQTDLIIPAQLNNSLEEQLKQAAANIFSYLKCKGM
ARVDFFVNDKTEEIYFNEINTLPGFTSISMYPKLWQATGIAYPDLLDELINLAMVHHNCR
QHLVTNYL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttggagacgctaatgtccaaacccgttaatttggttttactttatggtggaaaatcaggc
gagcatgaagtgtcattggtttctgccgcatcggttctaaaacacctggattccgagaaa
tatcatattatacccattgcaatggataaaagtggtcgatttcatcgtcatgattataat
gatttgctcgcctgttctgataaattacctgttgttactgaaaaatcaaccccattggaa
ggcttattaattaatggacgtctggcagttgatgctaaaattgtttttccagtggttcat
ggccctttatatgaggatggatgtttacaaggtttacttgagttagccggtgtcgcctat
gtaggatgtgacgtattgtcttctgcaatcggaatggacaaagacatggcgaggcgactc
gcatgtattaatgggctcaaatcagcaagatataaattattatcatggcatgccaatgcg
tctgaaagacaacaattttgtcatgaagtcgcctcggagtttggttggcctctgttcgtt
aagccatgctcactaggttccagtgtgggaattcacaaagcaaataatatggatgagcta
aacgcagcagttgctgatgcattacgctatgatgaagaaattctggttgaagaatttatt
gtcggaagggaaattgaactggcagtgttggagaacagtatcccctgtgggaaaccaaga
gtaagtatggtgggtgagataaaagtaaaccaccctgacggttattattcttatactgcg
aaatatttggaaagcagtcaaacggatttgattattccagctcaattaaataatagtctg
gaagaacaattaaaacaggctgcagcgaatatttttagttatcttaaatgtaaaggcatg
gccagggtagatttttttgtaaatgataagacagaagaaatttactttaatgaaataaat
acattacctggatttacctccataagtatgtaccccaaattgtggcaggcaactggtata
gcttatcctgatttacttgatgaattgattaatctagcaatggttcatcataactgtcgt
caacatttggtgacaaattacttgtga

DBGET integrated database retrieval system