KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12): lp12_2623
Entry
lp12_2623         CDS       T01726                                 

Definition
(GenBank) permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290 (serogroup 12)
Pathway
lpe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    lp12_2623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpe02000]
    lp12_2623
Transporters [BR:lpe02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    lp12_2623
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AEW52865
LinkDB
Position
complement(2931879..2932880)
AA seq 333 aa
MSNQFIQYLNRAASGSIPGFVIMKLLMLELPNLMGLLLPLGFYVALLLAYGRLYAESEMT
VLRACGYGPRQLLKHSFAMATVVLVVVAIVMIWASPVIAVERIKLIRSTGIKTLIQTIMP
GRFHAINSGQQIFYVQSMNRDHSQAEQIFMAKHSVQDNRLLWDVLWADKAFAEVNPQTGE
EYIVLQNGKEYQGVPGHADYQIAEFASYKSKLPNPTVVMHDDARTAKTRDLWPLNNHDLK
KAAELQWRISIPLMVLTLTLVAVPLSRVSPRSGKYSKLLPAIIIYIFYANFMFVSRDAIA
TGKIPWWIGMWWVHVAVAILGILFIWRNQVKLA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagtaatcaattcatacaatacttaaatcgcgctgcttctggttcaattcctggtttt
gtgatcatgaagttgttgatgttggagttgccaaatttaatgggtctgttactgccactg
gggttttatgtcgctcttttattggcgtatggccggttatatgccgaaagcgaaatgacg
gttctgcgagcttgtggttatggccccaggcaattactgaaacacagctttgcaatggct
actgttgtgttggtagtggttgccatcgtaatgatttgggcaagccctgtgattgctgtt
gaacgcatcaagttaatacgttctacaggaatcaaaactttaattcaaacgattatgcct
ggacgctttcatgccattaatagcggtcaacaaatcttttatgtccaatccatgaatcgc
gatcactcccaagcagaacagatattcatggcaaaacatagcgttcaggataataggctg
ttatgggatgtgttgtgggctgataaagcatttgctgaggttaatcctcaaacaggcgag
gaatacatcgtgctgcaaaatggcaaggaatatcaaggtgttccgggtcatgccgattac
cagattgcagaatttgcaagctataaatccaaattgcccaacccgactgttgttatgcat
gatgatgctcgcactgcaaaaacaagagacttatggcctttgaacaatcatgatttgaaa
aaggcggctgaattacagtggcgtatttccattcctttaatggttttgaccttgactctg
gttgccgttccacttagtcgtgtcagccctcgttctggaaaatattcgaaacttttgcca
gccatcattatctatattttttatgctaattttatgtttgtttctcgtgatgcgattgct
accgggaagattccctggtggatagggatgtggtgggtacacgtggcggttgccattctc
ggcatcctatttatttggcgcaatcaggtgaagcttgcatga

DBGET integrated database retrieval system