KEGG   Legionella pneumophila Lens (serogroup 1): lpl0355Help
Entry
lpl0355           CDS       T00208                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lpf03012]
    lpl0355 (tufA)
   03029 Mitochondrial biogenesis [BR:lpf03029]
    lpl0355 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpf04147]
    lpl0355 (tufA)
Translation factors [BR:lpf03012]
 Eukaryotic Type
  Elongation factors
   lpl0355 (tufA)
 Prokaryotic Type
   lpl0355 (tufA)
Mitochondrial biogenesis [BR:lpf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    lpl0355 (tufA)
Exosome [BR:lpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   lpl0355 (tufA)
  Exosomal proteins of breast cancer cells
   lpl0355 (tufA)
  Exosomal proteins of colorectal cancer cells
   lpl0355 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CAH14586
Pasteur: lpl0355
UniProt: Q5WZL4
LinkDB All DBs
Position
414391..415581
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAKAYDQIDAAPEERERG
ITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDFPGDDIPIIVGSALKALE
GEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFSISGRGTVVTGRVESGIVK
VGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLLRGTKRDEVERGQVLAKPGT
IKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGTCDLPSGVEMVMPGDNVQ
LVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaaatttgaacgtaagaagccgcacgtaaacgtgggcacgattggtcac
gtagaccatggtaagacgacattgacagcagctattacaacgattatggcgaagaaatat
ggtggtacagcgaaggcgtacgatcaaattgatgctgcgccagaagaaagagagcgtggt
attactatatctacagcccatgttgaatacgaatcagcgagcagacattatgcacacgta
gactgcccgggacatgctgactatgttaagaacatgattactggtgctgcgcaaatggac
ggagcgatactggttgtatcagcagctgatggtcctatgccacaaacgagggaacacatt
ctattgtctcgccaggtaggtgttccatatattgttgtgttcatgaacaaagcggatatg
gttgatgaccctgagttattagagttagtggaaatggaagtgcgagatttattaagcagt
tacgatttcccaggggatgatatacctattattgttggttcagctttgaaagcattggaa
ggtgaagacagtgatataggtgttaaggctattgagaaattagttgaaacaatggattca
tacattcctgagccagttagaaacatagacaagccattcttgttgccgattgaagacgtg
ttttcaatttctggacgcggaacagtggtaactggtcgtgttgagagtggaattgttaaa
gttggtgaggaagttgaaattgttggaataagagacacccaaaagacgacttgtactggt
gttgagatgttccgtaaattacttgatgaaggtcgagctggtgataacgttggtgtgtta
ttacgcggtacgaagcgagatgaagtggagcgcggacaggtattggctaagccaggaacc
atcaagccacacaccaagtttgaagcagaagtgtatgtattatcgaaggaagaaggcgga
cgtcacactccattctttaatggataccgtccacaattctatttcagaaccactgacgtg
acaggtacttgtgacttgccatcaggagttgaaatggtaatgcctggagataatgtgcaa
ttagttgttagcttgcatgctccgattgcgatggatgagggtttaagattcgcaattaga
gagggtggccgaactgttggcgccggtgtagtcgctaaaataatcgagtaa

DBGET integrated database retrieval system