KEGG   Legionella pneumophila Lens (serogroup 1): lpl0728Help
Entry
lpl0728           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    lpl0728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpf02000]
    lpl0728
Transporters [BR:lpf02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    lpl0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA AAA_16 ATP-synt_ab TniB Mg_chelatase RsgA_GTPase CbiA IstB_IS21 AAA_7 AAA_5 AAA_29 AAA_19 AAA_13 AAA_30 RNA_helicase Rad17 TsaE PRK NACHT AAA_33 TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: CAH14962
Pasteur: lpl0728
UniProt: Q5WYK8
LinkDB All DBs
Position
818815..820626
Genome map
AA seq 603 aa AA seqDB search
MQNNAKINQLSVAFKSPDKTVLALDKLSFSLNPGETLVLLGESGCGKSLTSLAMMRLLPR
AGVYGIDSQINIHDEDILNLPEKMMRELRGRRLAMIFQEPMTALNPVLTIGEQIAEVLKR
HRSLTKGQIKERVILLLNEVEMPQPQMRIYQYPHQLSGGQKQRVVIAMALACEPDILIAD
EPTTALDVTIQAQILTLLKKIQKKHQMSLLLITHDLGVAKTMADRICVMYAGQVVEQASV
KDFFSKVRHPYVQQLLTSLPSFAKRNEKLSIIAGTVPSLESMPSGCRFHTRCIYAFERCY
HEEPQLQEVEQRMLRCHLYPDIKELPLLDKNKISWVPSVEKEEIVFTVDDLSVHFIHKKG
FLSRKKTIFKAVDGLSFTLSRGKTLALVGESGCGKTTASRALLRLLPAAGGKVRYKDSDV
LSMTGSALRRYRKKVQIIFQDPFSSMNPRMTVGEIIAEGMHAQGMKPSYIRKQQKFLIEQ
VNLPSTSLHRYPHQFSGGQRQRICIARALATEPDILICDEPTSALDVSVQAQILNLLKEL
QQQRGISYLFITHNMGVVSYIADDVLVMKDGLAVEYGSCEKVLHQPEHPYTRQLLNAVLD
IES
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaacgctaaaattaatcaattgtcagttgcttttaaaagccctgataaaaca
gttctggctttggataaattaagttttagcctaaatccaggggagactttggttttattg
ggagagtcaggatgtggtaaatcattaacttcattggctatgatgagattgctgcccagg
gctggtgtttatgggattgacagccaaatcaatattcacgatgaagacatcttaaattta
cctgagaaaatgatgagggagttaagagggcgcaggctggcgatgatttttcaagagccg
atgactgctttaaatcccgtattaacgattggagagcagatagccgaggttttaaaaagg
catcggtctttgacaaaagggcaaataaaagaaagagtaatattgttattgaatgaggta
gaaatgcctcaaccacaaatgagaatttatcaatacccacatcaattgtctggtggtcaa
aagcagagggtggttattgctatggcgttggcttgcgagccagatatccttattgccgat
gaacctactacggctttggatgtgactatccaggctcaaatattgaccttactaaagaaa
atacaaaagaaacatcagatgagtctgttattaattactcatgatctgggtgtggctaaa
accatggctgatagaatttgtgtgatgtatgcagggcaggtagtggaacaggcctcagta
aaagattttttttcaaaagtgagacatccctatgtccagcaacttttgacatccctacct
tcatttgcaaaaagaaatgaaaaactttctatcattgcaggtacggtaccttctttggaa
tctatgccttcagggtgtcgtttccatacacgctgtatttatgcttttgaacgttgttac
catgaggagcctcaattacaagaagttgaacagcgtatgttgagatgtcatttgtatcct
gatatcaaagaattgccattactggataaaaataaaatcagttgggttccttcggttgaa
aaagaagagatcgtgttcacagtagatgatttatcagttcattttatacataagaaagga
tttttgagccgtaaaaaaaccattttcaaagccgttgatggtttgtcgttcactctctcc
agaggtaaaacattagctttggttggagagtcgggctgtgggaaaacaactgcaagccgt
gctctgttgaggttattgccagcggccggggggaaagtcagatataaagatagtgatgta
ctgtctatgacaggaagcgctttaagaagatacagaaaaaaagtacagattatttttcaa
gatcctttttcttctatgaatccacgcatgacagttggagagatcatcgcagaagggatg
catgcacagggaatgaagccctcttacatcaggaaacaacaaaaattcctaattgagcaa
gtgaacttaccaagtaccagtctgcatcgatacccccatcagttttccggtggacaaaga
caacggatctgcatcgcgagagctttggcgacagaacccgatattttaatctgcgatgaa
ccgaccagtgctcttgatgtctctgttcaggcacaaattcttaatttattaaaggaattg
caacagcaaagaggtatttcctatttgtttataacccataacatgggggtcgtctcttat
atcgctgatgatgtattagtcatgaaagacggtttggctgtcgagtatggttcatgtgag
aaggtacttcaccaaccagaacatccttataccaggcagctgttaaatgcagtcttagac
attgagtcataa

DBGET integrated database retrieval system