KEGG   Legionella pneumophila Lens (serogroup 1): lpl1034
Entry
lpl1034           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
SSDB
Motif
Pfam: DUF5104
Other DBs
NCBI-ProteinID: CAH15269
Pasteur: lpl1034
UniProt: Q5WXQ7
LinkDB
Position
complement(1164732..1165319)
AA seq 195 aa
MKKFLDAKWLGLVVLNVLVIVFVCVKHQSSSINNNNLNGLEQKLITIQSQLNKPNQQPDL
SPITDNIKQLGDFIQQMQNKDDHQLGDLFSTQQAAIKNQLDGIRELLKHLDSQKQPIKML
PASELPFRVLSIDSVQEVSVASVAYDYKTQALEKGDSLARWKILDINFAKQTIEFENADK
AHVLIHLTQQEVNNE
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagaaatttctggatgccaaatggcttggcctggttgttttaaatgttctggtgatt
gtgtttgtgtgtgtaaaacaccaatcttcatccatcaataataacaatctgaatggtctg
gaacaaaaacttataactattcaatcgcaattaaataaacctaaccaacaacccgacctt
tctcctattactgacaatatcaaacagcttggggatttcatccaacaaatgcaaaacaaa
gacgaccatcaattaggtgatcttttttcaacccaacaagctgctattaaaaaccagctt
gatggcattagagaattgttgaagcatttagatagccaaaagcagcctattaaaatgctg
ccagcaagcgaacttccttttagagttttaagcatagacagtgtacaggaagtttcagtc
gcatcggttgcttacgattataaaacccaagccctagagaaaggggattccctagccaga
tggaaaatcctagatatcaattttgccaagcaaactatcgaatttgagaacgcagataaa
gcccatgtcctgatccatttgacccaacaagaggtgaacaatgaataa

DBGET integrated database retrieval system