KEGG   Legionella pneumophila Lens (serogroup 1): lpl2411Help
Entry
lpl2411           CDS       T00208                                 

Gene name
lepB
Definition
(GenBank) effector protein B, substrate of the Dot/Icm secretion system
  KO
K15492  effector protein B
Organism
lpf  Legionella pneumophila Lens (serogroup 1)
Pathway
lpf05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:lpf00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    lpl2411 (lepB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LepB_N LepB_GAP_N LepB_GAP_C
Motif
Other DBs
NCBI-ProteinID: CAH16651
Pasteur: lpl2411
UniProt: Q5WTW2
LinkDB All DBs
Structure
PDB: 

Position
2740414..2744298
Genome map
AA seq 1294 aa AA seqDB search
MLTYQGKEIVRFKEKTGGKNKSDVDGFYKDSDGRKFFIKKPGDPRELFTELFAGLLLKEF
MKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKIIGTSYGDGSDRNTIKETF
FGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLKGEGEEKSKQFGRIDWGDA
FRYFAHRNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPE
LLIEIVTSALKNIPADLIEEKTKIQLAAYMCMDSFKEVTFGPKGNCKDFAIAMATLLENR
LGKIAVLKDMSPLSNPEELYQSILELKPLTLLMTSSTSFSETINQWADILKTTDMEKFSF
DSNPINLPELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAIHGHAFV
PYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQTLLTLGNGIINT
LKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADVKKSLKVPSFAEPLPDKESEFFYP
IDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDP
AGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIKKQTIEFEELEATLIQIKEKY
QLLEKMAEQSEHEKSSAQSIIRSLNLELGQLKLQLQEQEKLQFQLKELKEKIHEQTTLSK
RLGEELQTQKKTNTHQEETIQRITKEKSLADSSLESLRKELHELAKKERSLHKTLEEKQL
QVQELEEQLAEKEKENLALKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQETLELQ
LKSLRKQIQEQTLLVEGLKEELQKQKKSNTHQEETIERITKEKSLADSALESLRKEMHEL
TRKNEENQLKLTKQVHSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKEKASEKRTVASL
REQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIVEDQKRQLEELKIKIQELV
SANQELGKQNQSLSKENLHNKNTVEDLEKKLTELNVQLEQLHQSSNEKEQTIRKLREELI
KKDSSLKQNEEMQLAQKHLQEEIDRLQKEIKQQQLNTNQLESIVAQSKEAEKRYQQALQQ
KKGIYLARMERVSPIYLQIQQIEQKAKELEERRETEASTAAKTLATKLRLEIKNYLDNNE
SDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKAT
TGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atgttaacttatcaaggtaaagaaatagttcgatttaaagaaaaaacaggtggtaaaaat
aaaagtgatgtcgatggtttttacaaagacagcgatggccggaaattttttataaaaaaa
ccgggggaccctcgtgagctattcacagaattatttgcaggcttgctattaaaagagttc
atgaagcgaggattgattgatgaaagctattttccatcattgatttgcgcagatgtcatt
caatttgaagacaaatcctatggcctgatacagccgctggtttcatttgatgaattacac
aaaatcattggaacaagctacggtgatggcagtgatcgtaatacgataaaggaaaccttc
tttgggccaggttattatgccgggatcacaaaacaaaataaatattttggcctttctatg
gcccttatgttttctctattgctgggagcccatagtgtacatagtggcaatatcgttgta
ctcaaaggagaaggagaagaaaaaagcaaacaatttggccgaatcgattggggagatgcc
ttccgttatttcgctcatcgaaacaataatgacaatctcctttatgcttatgaaaacaga
ggttggtttaattataaatcactaactaaagattatttcctgaactataagaagatcaat
ggcctcttccctgcgatggctgaaaaagcccgacaattgcaatccaaactaaatcctgaa
ttgcttattgaaatagtaactagcgcactcaaaaatattccagctgatctgatagaagaa
aaaaccaaaatccaacttgctgcctacatgtgtatggattcatttaaagaggtaacattt
ggcccaaagggtaattgcaaagattttgccattgccatggctacattattagaaaatcgt
ttaggaaaaattgctgttcttaaagatatgtccccattgagcaatcctgaagagctgtat
caaagtattttggaattaaaacccttgacgcttcttatgacctcttcaacctctttttca
gaaaccataaatcaatgggcagatatcttaaaaactacagacatggaaaaattttcgttt
gatagtaatccaatcaacctaccggaattagtcaaacaatttaacctttacgttgatgaa
ctagccatcacgtgtgaagccaataatgtctgggcaaaagaaagaatagacagcacccct
aatctgtttgctctctatgataatagcggtggtgaagcgattcacggacatgcctttgtt
ccttactacaaagaaagcattgtattgcgccgcctatttacagtagaccctaatactttc
aacttatctcgttttgctgcttttgaaggaccatgccaactctattgcaaggaacataaa
gactctgcctgggttaaaatccaaaccttactgactttaggtaatggaattattaatacg
ctaaaaataatcaaacaggctcaagcattcggaatagatgaggcagttacagagaattta
aaagcattgaaagaacaattcattgcttttcaacttgcggaagctgatgtaaaaaaatca
ttaaaagtaccttcttttgcagagcccttgcctgataaggaaagtgagtttttttatccc
attgatgaaaaagcattagctaaaatgaatggatatcaacttgcaacgatttgtctggaa
gaactaaatagccctaaaccgtcgcctttaattgaaagaattctcagtaataaaaaattt
tggaaacgtattaactctgcttttgaaagtggtgtatttaaaggccgcacagatgatccc
gccggtaaaatagctaaaatccgtgaatggcatcaattattacagatttctggtaaaaaa
actgctggacaaattgatgagctgcaaaagatagtaatttctcttcaatcaaaaattaaa
aagcaaacgattgaatttgaggagctggaagcgactttaatccaaataaaagaaaaatat
cagttactggagaaaatggctgagcaaagcgaacatgagaaatcttccgcccaatccatt
attcgctctctgaatttagaactgggtcagcttaaattacaactgcaagagcaagaaaaa
ttacagttccaattaaaagaactcaaagagaaaatacatgaacaaacgactctatccaag
cgattaggagaggagctgcaaacgcaaaagaaaaccaacacgcaccaggaagaaaccatt
caaagaatcaccaaagaaaaatcattggctgattcttcccttgagtcgcttcgaaaagaa
ctgcatgaattggcaaaaaaagaacgctctcttcataaaacgctcgaagaaaaacaatta
caagtacaagagttagaagagcaattagcagagaaagaaaaggaaaatctagccctgaaa
aaagctgacaaacaaagtcaacatgaaaaatccctggataaatctgctattgaatctcta
acttcagagcttaatcagcttaaattagaactgcaaaaacaagaaacattagaattgcag
ttaaaatctttaagaaaacaaattcaagagcaaacattgcttgtagaaggcttgaaagag
gagttacaaaaacaaaagaaaagcaacacacaccaggaagaaactattgaaagaatcact
aaagaaaaatcattggctgattctgctcttgaatcgcttcgaaaagagatgcatgaatta
actcgaaaaaacgaagaaaatcaacttaaattaacaaaacaagtccactctcttagtgaa
caacttgaagagaaacaattacaaattagggaatttgagaagcaattacaagaaaaagaa
aaaagagtcgagcaaagtgagaaagagaaagcttccgaaaaacgaactgtggcttcactt
agggagcaagtaagcaatttaaaattgcaattacagcaacttggagaggtaattcaggaa
aaagaaaaaggctcctctttgataagccagcaatccaaacaaattattgctcttcaagag
attgtagaagatcaaaaaagacaattggaagaattgaaaataaaaattcaggaacttgta
tctgcaaatcaagagcttggaaaacaaaatcaaagtttgagcaaggaaaatttacataat
aagaatacagttgaagatcttgagaaaaaattgaccgaattaaatgttcaattggaacaa
ttgcaccaatcttcaaatgaaaaagaacaaaccattagaaaattgagagaagaactcatt
aagaaagattcttcgctcaaacaaaatgaggaaatgcaattagcccaaaaacatctgcaa
gaggaaattgatcgtctacaaaaagaaattaaacaacaacaattaaatacaaatcaatta
gaatctatagttgctcaaagtaaagaggctgaaaaacgctatcagcaagctttacaacag
aaaaagggaatttaccttgcgcgaatggaaagagtgtctcctatttatttgcaaatacag
caaattgaacaaaaggccaaagaattggaggaaagaagggaaacagaagcatcaacagcg
gcaaaaacactcgcaacaaaacttcgtttagagataaaaaattatctcgacaataatgag
tccgatgaaaaaagtgccttaaactcattcaaaataaatgccaaacggcatattgaaaac
tcgaaggaaacgctaaatcaacatcgggaagaatggaagtacctgttagccaatgttact
ttaggggtattcttgcttggaatcggttatctcgccgctattttgattaacaaagcaact
actggcaattatacctttttcagccaaactaacagcgggaaaaaattggacgcgttggaa
aaagcgatttcttccactcactccgaaacattagtttatggataa

DBGET integrated database retrieval system