KEGG   Lactobacillus pentosus: BB562_04605Help
Entry
BB562_04605       CDS       T05251                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lpg  Lactobacillus pentosus
Brite
KEGG Orthology (KO) [BR:lpg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpg02000]
    BB562_04605
Transporters [BR:lpg02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BB562_04605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_30 SMC_N RsgA_GTPase AAA_16 TsaE DLIC NACHT DUF3584 AAA_13 PIF1 DUF2791 AAA_22 AAA_29 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AUI78028
UniProt: A0A2K9HZJ7
LinkDB All DBs
Position
1038399..1039118
Genome map
AA seq 239 aa AA seqDB search
MTQMATLTLKNVAYKHNQRQILQDVQLVLSAGKIVGLLGENGAGKTTLMRLIMGTAKGRG
EIRVNGEAGVVARKQHISFTDHLSGFSTGMKLEQIAKFYASVYPDFDTTRYQEMVAFLEL
DAQQKLGELSKGTREKLIIALTLSRQAAVYLLDEPFSGIDSMSRKKIINSIIKWTPDEAI
LLISDHYVSEIAPILDEIVVVKDQTITLHQATDEIRDRYGIELEDYYEQLYTGGATDDK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatggcaacattgacgcttaaaaatgtcgcgtacaagcacaatcaacggcag
attttacaagatgtacaattagtactttcagcaggaaaaatcgtcggcttgttaggtgaa
aacggggctgggaagacgactctgatgcggctcatcatgggaacggcgaaaggccgcggt
gagattcgggtcaacggtgaagctggcgtggttgcccgtaaacaacacatcagttttacg
gaccacctcagcggatttagtaccggcatgaaattagaacagattgcgaaattttatgcc
agtgtttatccagacttcgatacaactcggtatcaggaaatggtggcgttcttggaactc
gacgctcaacagaaattaggcgagttgtccaaggggacccgagaaaagctgattattgcg
ctgacgctgagtcgtcaggcggccgtttatttactggacgagccattcagtggtatcgac
agcatgagtcgtaagaaaatcatcaacagtattattaagtggacccctgatgaggccatt
ctgctcatcagcgaccactatgtcagtgaaattgcgccgatcttagacgaaatcgtggtc
gtcaaagaccaaacgatcacgttgcaccaggcgactgacgagattcgtgatcggtatggc
attgaattagaagattattatgaacagttgtatacgggaggtgcgacggatgacaaatag

DBGET integrated database retrieval system