KEGG   Lactobacillus pentosus: BB562_06470Help
Entry
BB562_06470       CDS       T05251                                 

Definition
(GenBank) adaptor protein MecA
  KO
K16511  adapter protein MecA 1/2
Organism
lpg  Lactobacillus pentosus
Brite
KEGG Orthology (KO) [BR:lpg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BB562_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MecA TP6A_N
Motif
Other DBs
NCBI-ProteinID: AUI78346
UniProt: A0A2K9I0D1
LinkDB All DBs
Position
1411430..1412161
Genome map
AA seq 243 aa AA seqDB search
MEMERINEDTIRVVIGNDDLNERGIRVLDLLGNHKQIESFFYSILEEVDVDHQFQDNDAV
TFQVLPNRNGLELFISKNSDNLQDTIAKATQSPNQSDDGDSQDDVSDYLKRKLMQTDTNR
VEDGQGVSHNPTKDTNDLDPYIDDPDTPTKEYVLKFDQFEDLVSLAQLFRPEGLTSNLFK
YRDQYYLELVFFVDQSSTATIKDDVAVALEYAHLANISADVLLEHGEKIMSNAALETIRH
YFH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaacgcatcaacgaagatacgattcgcgtcgttattggaaatgatgatctc
aatgagcgcgggatacgcgtgttggatttactagggaatcataagcaaattgaaagtttc
ttttatagcatcttggaggaagttgatgttgatcatcaatttcaagacaacgatgcggtg
acttttcaagtactaccgaaccgcaatggcctagaattatttattagtaaaaatagtgat
aatttacaagatacgattgccaaagcgacccagtcgcctaatcagtcggatgatggtgat
tcacaagatgacgtctcggattacttgaaacgcaaactaatgcagaccgatacaaatcga
gtggaagatggacaaggtgttagtcataatccgactaaggataccaacgatttagatcca
tatatcgatgatcctgatacgccaactaaagaatacgtgttgaaatttgaccagtttgaa
gatttggtctcgttggcacagttattccggccagaaggtttgacttccaacttgtttaag
tatcgtgatcaatactatctagaattggttttcttcgtggaccaatcttcaacggcaacc
atcaaagatgatgttgcagttgccttagaatatgcccacttagcgaatatatcagctgac
gtgttgcttgaacatggtgaaaaaatcatgtcaaacgccgcacttgaaacgattcgccac
tattttcattaa

DBGET integrated database retrieval system