KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_0523Help
Entry
LPV_0523          CDS       T02174                                 

Definition
(GenBank) putative Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
Pathway
lph00500  Starch and sucrose metabolism
lph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPV_0523
Enzymes [BR:lph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LPV_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 Complex1_LYR_2
Motif
Other DBs
NCBI-ProteinID: CCD07746
LinkDB All DBs
Position
complement(516608..517891)
Genome map
AA seq 427 aa AA seqDB search
MIFFVSQTMASVFTHEEVQILKKHFLNNFQANGAIVASPSQYNPNYYYDWIRDSAIAMGL
VETWYEASQSARYKKLLLQYVSWTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQ
NDGPALRASVLIRFAQQLLDHNEIGYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANF
DLWEEVYGHHFFTAMAQQKALTDGAILAHQLHDRQAAVFYEMQANLINSRLQQHLDHQNK
IIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHEQFNLMFPI
NKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSPNSSNKLHIQN
YLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIK
TMGWNTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggttcaaata
ttaaaaaaacattttttaaataactttcaagccaatggagccatcgtcgcctcaccctcg
caatacaaccccaattattattatgactggattcgagactcagcgattgccatgggattg
gttgagacatggtatgaagccagccaatctgctcgatataaaaaacttttattacaatac
gtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggatatattg
ggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacgaccacaa
aatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagcttctcgat
cataatgaaataggctatgtcaaatcacatctttataacaacaccatggacccacaatcc
atgggcactatcaagatggatttggaatacatcgcacatcattggcaagatgcaaatttt
gacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaaaaagcg
ctgaccgatggcgccattttggctcaccaacttcatgacagacaagctgctgttttttat
gaaatgcaagccaacctaattaacagtcgactgcaacagcatttggaccatcagaataaa
ataattcaagccacattattacctcaccctggtcctcaaaaaacactagagcttgattcg
tccgtcatgttgggtattttaactaacccacaaaaagaaggtgtttttgcgccacatcac
acctttgtgcgaaatactgcaaaggctttgcatgagcaatttaatttgatgtttcctatt
aataaaaaccgttctggagcaatattgtttggtcgttatcccggcgatacttatgatggc
taccaaacaaacagcatagggaacccctggtttatcttaacagctacgatggccgaatat
tattttaccatggctcataatctgtccccgaacagcagtaataaacttcatatacagaac
tatctaaagaaaggagacaattacctaaggctgataaaacaatatggccctgatctgaat
ttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttgacctgg
agttacgtttccgtcttgcgagctattcatttaagagagcaattggaaaatagaataaaa
actatgggctggaatacctattag

DBGET integrated database retrieval system