KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_1142
Entry
LPV_1142          CDS       T02174                                 

Definition
(GenBank) putative membrane protein
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
SSDB
Motif
Pfam: DUF3487 PrgI DUF4752 DUF3040
Other DBs
NCBI-ProteinID: CCD08324
LinkDB
Position
complement(1152596..1152958)
AA seq 120 aa
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIG
FIFSITVWPKGVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagtcagccttcttcgcgccatctatcacatgactttccagcctggaaaggcttaagt
ctgcgtgaattgttttggattgtcatcactacaacaccagtaactaccttgctttttatt
cttttaggaacaatggcagggtatccactagccgctggctgcatcggttttgtgattgga
ttcatcttctccattaccgtatggccaaaaggagtcgcccgtatcaaagcaggcaaacct
tatggttatgtgatgaagaaaaccattcaatggatggtgcgattaaggctcaaacactcg
ccctggattcattatcaggggcagtggcaaaagaataaatctgttggagagcctcatgtt
tga

DBGET integrated database retrieval system