KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_1641Help
Entry
LPV_1641          CDS       T02174                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 6a)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
Pathway
lph00550  Peptidoglycan biosynthesis
lph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPV_1641 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lph01002]
    LPV_1641 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lph01011]
    LPV_1641 (dacC)
Enzymes [BR:lph01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPV_1641 (dacC)
Peptidases and inhibitors [BR:lph01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LPV_1641 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:lph01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LPV_1641 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CCD08787
LinkDB All DBs
Position
1664692..1665915
Genome map
AA seq 407 aa AA seqDB search
MTRATSFLLTLLFFITLFVQSTNSMADEVLPSSDLQKPSPTVTTKPFTTPAAPLLNAKAY
ILIDVNSGKVIAEKNSEEKLPPASLTKMMTLYVISNALKSGQIHLNDMVRVSRDAWQTGG
SRMFIKEGDQVSVEDLLKGIIVDSGNDACVAMAEHLGGSENAFTDIMNQQAQNLGMKNSH
FTDSTGLPDPNLYTTAKDLAILGRALILDFPEYYDWYKQKWFTYNGIRQPNRNRLLWRDS
QVDGIKTGHTNDAGYCLVSSAKRNNMRLLAVVLGEPSDSVRADDSEKLLNYGFRFFETHQ
LYKSGQSIAELPLYKGTSDKVAVGLTEDQFITIPAGQYERLNISTKISNDLQAPIKKGDK
VGDIIVQFNNNIVSSKPLYALQTVESGGFYTRTKDSIRLAFKRWFGS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagcaacgtcttttttattgacgctattattttttattactttatttgtacag
tctaccaattcaatggctgatgaagtgctcccctcatctgatttgcagaagccttctcca
acagtcacaacgaaaccttttacaactccggctgctccattgcttaatgccaaagcttat
attttaattgatgtgaatagtggaaaagtaattgcagaaaagaatagtgaggaaaaatta
ccacctgccagtttgaccaaaatgatgacgctttatgtcatttctaatgcattgaagagc
gggcaaatccatcttaatgatatggtaagagtaagccgtgatgcatggcagactggtggc
tctcgtatgtttataaaagagggagatcaggtctctgttgaagaccttttaaaaggcatt
atagtagactctggtaatgacgcttgtgtggcaatggcagagcatcttggtggttccgaa
aatgcttttaccgacattatgaatcagcaagctcaaaatctgggtatgaaaaatagtcat
tttacagacagtactggattacctgatcctaatctatatacaactgctaaagatttggcg
attttaggccgagccttaatactcgatttccctgaatactatgactggtataaacaaaaa
tggtttacatataacggtatacgccaacctaataggaaccgtttgttgtggcgagatagc
caagttgacggtataaaaacaggccacaccaatgatgctggatattgtctagtatcttcc
gcaaagcgtaataacatgcgtttattagctgtggttttaggggaacccagtgattctgtg
cgtgctgatgacagtgaaaaattgctaaattacggatttagattttttgaaacacatcaa
ttatataaatctgggcaatcaattgccgaattaccgctttacaaaggaacttctgataaa
gttgctgtgggtttaacagaggatcaatttattacgatacctgccggtcaatatgaaaga
ttaaatatttcaactaaaatttctaatgatttacaagctcctataaaaaaaggcgataaa
gttggcgatattattgtgcaatttaataacaatatcgtttcaagcaaaccgctttatgct
ttgcaaacagtggagtcaggtgggttctataccagaacaaaagattcgataaggttagca
tttaagcgatggttcggttcctag

DBGET integrated database retrieval system