KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_2816Help
Entry
LPV_2816          CDS       T02174                                 

Gene name
lepB
Definition
(GenBank) effector protein B, substrate of the Dot/Icm secretion system
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LepB_N LepB_GAP_N LepB_GAP_C
Motif
Other DBs
NCBI-ProteinID: CCD09869
UniProt: A0A3A6VUI8
LinkDB All DBs
Structure
PDB: 

Position
2901942..2905826
Genome map
AA seq 1294 aa AA seqDB search
MLTYQGKEIVRFKEKTGGKNKSDVDGFYKDSDGRKFFIKKPGDPRELFTELFAGLLLKEF
MKRGLIDESYFPSLICADVIQFEDKSYGLIQPLVSFDELHKIIGTSYGDGSDRNTIKETF
FGPGYYAGITKQNKYFGLSMALMFSLLLGAHSVHSGNIVVLKGEGEEKSKQFGRIDWGDA
FRYFAHRNNNDNLLYAYENRGWFNYKSLTKDYFLNYKKINGLFPAMAEKARQLQSKLNPE
LLIEIVTGALKNIPADLIEEKTKIQLAAYMCMDSFKEVTFGPKGNCKDFAIAMATLLENR
LGKIAVLKDMSPLSNPEELYQSILELKPLTLLLTSSTSFSETINQWADILKTTDMEKFSF
DSNPINLMELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSGGEAMHGHAFV
PYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCKEHKDSAWVKIQNLLTLGNGIINT
LKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADVKESLKAPSFAEPSPNKESEFFYP
IDEEALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGIFKGRTDDP
AGKIAKIREWHQLLQISGKKTAGQIDELQKIVISLQSKIKKQTIEFEELEATLIQIKEKY
QLLEKMAEQSEHEKSSAQSIIRSLNLELGQLKLQLQEQEKLQFQLKELKEKIHEQTTLSK
RLGEELQTQKKTNTHQEETIQRISKEKSLADSSLESLRKELHELVKKERSLHKTLEEKQL
QVQHLEEQLAEKEKENLTLKKADKQSQHEKSLDKSAIESLTSELNQLKLELQKQETLELQ
LKSLREQVQEQTLLVEGLKEELQKQKKSNTHQEETIERITKEKSLADSALESLRKEMHEL
TRKNEENQLKLTKQANSLSEQLEEKQLQIREFEKQLQEKEKRVEQSEKEKASAKRTVTSL
REQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIEDQKRQLEELKIKIQELV
SANQELGKQNQSLSKENLHNKNTVEDLKKKLTELNVQLEQLHQSSSEKEQTIRKLREELI
KKDSSLKQNEEMQLAQKHLQEEIDRLQKEIKQQQLNTNQLESIIAQSKEAEKRYQQALQQ
KKGIYLARMERVSPIYLQIQQIEQKAKELEERRETEASTAAKTLAKKLRLEIKNYLDNNE
SDEKSALNSFKINAKRHIENSKETLNQHREEWKYLLANVTLGVFLLGIGYLAAILINKAT
TGNYTFFSQTNSGKKLDALEKAISSTHSETLVYG
NT seq 3885 nt NT seq  +upstreamnt  +downstreamnt
atgttaacttatcaaggtaaagaaatagttcgatttaaagaaaaaacaggtggtaaaaat
aaaagtgatgtcgatggtttttacaaagacagcgatggccggaaattttttataaaaaaa
ccgggcgaccctcgtgagctattcacggaattatttgcaggcttgctattaaaagagttc
atgaagcgaggattgattgatgaaagctattttccatcattgatttgcgccgatgtcatt
caatttgaagacaaatcctatggcctgatacagccactggtttcatttgatgaattacac
aaaatcattggaacaagctacggtgatggcagtgatcgtaatacgataaaggaaaccttc
tttgggccaggttattatgccgggatcacaaaacaaaataaatattttggcctttctatg
gcccttatgttttctctattgctgggagcccatagtgtacatagtggcaatatcgttgta
ctcaaaggagaaggagaagaaaaaagcaaacaatttggccgaatcgattggggagatgcc
ttccgttatttcgctcatcgaaacaataatgacaatctcctttatgcttatgaaaacaga
ggttggtttaattataaatcactaactaaagattatttcctgaactataagaagattaat
ggcctcttccctgcgatggctgaaaaagcccgacaattgcaatccaaactaaatcctgaa
ttgcttattgaaatagtaactggtgcactcaaaaatattccagctgatctgatagaagaa
aaaaccaaaatccaacttgccgcctacatgtgtatggattcatttaaagaggtaacattt
ggcccaaagggtaattgcaaagattttgccattgccatggccacattattagaaaatcgt
ttaggaaaaattgctgttcttaaagatatgtccccattgagcaatcctgaagagctgtat
caaagtattttggaattaaaacccttgacgcttcttctgacctcttcaacctctttttca
gaaaccataaatcaatgggcagacatcttaaaaactacagacatggaaaaattttcgttt
gatagtaatccaatcaacttaatggaattagtcaaacaatttaatctttacgttgatgaa
ctagccatcacgtgtgaagccaataatgtctgggcaaaagaaagaatagacagcacccct
aatctgttcgctctctacgataatagcggtggtgaagcgatgcacgggcatgcctttgtt
ccttactacaaagaaagcattgtattgcgccgtctatttacagtagaccctaatactttc
aacttatctcgtttcgctgcttttgaaggaccatgccaactctattgcaaggaacataaa
gactctgcctgggttaaaatccaaaacttactgactttaggtaatggaattattaatacg
ctaaaaataatcaaacaggctcaagcattcggaatagatgaggcagttacagagaattta
aaagcattgaaagaacaattcattgcttttcaacttgcggaagctgatgtaaaagaatca
ttaaaagcaccttcttttgcagagccctcgcctaataaggaaagtgagtttttttatccc
attgatgaagaagcattagctaaaatgaacggatatcaacttgcaacgatttgtctggaa
gaactaaatagccctaaaccgtcgcctttaattgaaagaattctcagtaataaaaaattt
tggaaacgtattaactctgcttttgaaagtggtatatttaaaggccgcacagatgatccc
gccggtaaaatagctaaaatccgtgaatggcatcaattattacagatttctggtaaaaaa
actgctggacaaattgatgagctgcaaaagatagtaatttctcttcaatcaaaaattaaa
aagcaaacgattgaatttgaggagctagaagcgactttaatccaaataaaagaaaaatat
cagttgctggagaaaatggctgagcaaagcgaacatgagaaatcttccgcccaatccatt
attcgctctctgaatttagaactggggcagcttaaattacaactgcaagagcaagaaaaa
ttacaattccagttaaaagaactcaaagagaaaatacatgaacaaacgactctatccaag
cgattaggagaggagctgcaaacgcaaaagaaaaccaacacgcatcaggaagaaaccatt
caaagaatcagcaaagaaaaatcattggccgattcttcccttgagtcgcttcgaaaagaa
ctgcatgaattggtaaaaaaagaacgctctcttcataaaacgctcgaagaaaaacaatta
caagtacaacacttagaagagcaattagcagagaaagaaaaggaaaatctaaccctgaaa
aaagctgacaaacaaagtcaacatgaaaaatccctggataaatctgctattgaatctcta
acctcagagcttaatcagcttaaactagaactgcaaaaacaagaaacattagaattgcag
ttaaaatctttaagagaacaagttcaagagcaaacattacttgtagagggcttgaaagag
gagttacaaaaacaaaagaaaagcaacacacaccaggaagaaactattgaaagaattact
aaagaaaaatcattggctgattctgctcttgaatcgcttcgaaaagagatgcatgaatta
actcgaaaaaacgaagaaaatcaacttaaattaacaaaacaagccaactctcttagcgaa
caacttgaagaaaaacaattacaaattagagaatttgagaagcaattacaagaaaaagaa
aaaagagttgagcaaagcgagaaagagaaagcttcagcaaaacgaactgtgacttcactt
agggagcaagtaagcaatttaaaattgcaattacagcaacttggagaggtaattcaggaa
aaagaaaaaggctcctctttgataagccagcaatccaaacaaattattgctcttcaagag
attatagaagatcaaaaaagacaattggaagaattgaaaataaaaattcaggaacttgta
tctgcaaatcaagagcttggaaaacaaaatcaaagtttgagcaaggaaaatttacataat
aagaatacagttgaagatcttaagaaaaaattgaccgaattaaatgttcaattggaacaa
ttgcatcaatcctcaagtgaaaaagaacaaaccattagaaaattgagagaagaactcatt
aagaaagattcttcgctcaaacaaaatgaggaaatgcaattagcccaaaaacatctgcaa
gaggaaattgatcgtctacaaaaagaaattaaacaacaacaattaaatacaaatcaatta
gaatctataattgctcaaagtaaagaggctgaaaaacgctatcagcaagctttacaacag
aaaaagggaatttaccttgcgcgaatggaaagagtgtctcctatttatttgcaaatacag
caaattgaacaaaaggccaaagaattagaggaaagaagggaaacagaagcatcaacagcg
gcaaaaacactcgcaaaaaaacttcgtttagagataaaaaattatctcgacaataatgag
tccgatgaaaaaagtgccttaaactcattcaaaataaatgccaaacggcatattgaaaac
tcgaaggaaacgctaaatcaacatcgcgaagaatggaagtacctgttagccaatgttact
ttaggggtattcttgcttggaatcggttatctcgccgctattttgattaacaaagcaact
actggcaattatacctttttcagccaaactaacagcgggaaaaaattggacgcgttggaa
aaagcgatttcttccactcactccgaaacattagtttatggataa

DBGET integrated database retrieval system