KEGG   Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1): LPV_2923Help
Entry
LPV_2923          CDS       T02174                                 

Definition
(GenBank) putative Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035 (serogroup 1)
Pathway
lph00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPV_2923
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lph01002]
    LPV_2923
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lph01011]
    LPV_2923
Enzymes [BR:lph01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LPV_2923
   3.4.21  Serine endopeptidases
    3.4.21.-  
     LPV_2923
Peptidases and inhibitors [BR:lph01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   LPV_2923
Peptidoglycan biosynthesis and degradation proteins [BR:lph01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LPV_2923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CCD09966
UniProt: A0A3A6VNY3
LinkDB All DBs
Position
complement(3008834..3010627)
Genome map
AA seq 597 aa AA seqDB search
MKRTLTGAFMWAVWSLSSHAASMQFEVDKLINRLNPRVNLGIVVTDLTSGETLYKRNANR
LYIPASNMKLFSEAAALMALGPDYQFKNQLSTSANQLQQGVLHGNLYLHLSGDPSFSRED
LKALLSSLKDWNITTIQGNVIIDSSLMSIPAYPPGWLTSDLSYSYGAPIAPLMVDSNRLT
ITVNPGAKAGAPAIVEVDDGGGTINLNNQATTKASEKGCGVGFYLDPENNLTVRGCVGLG
QWAVQQRIAIKNPFVYAQGMIVSELAKSNIKLNGQVLLGRAPAGTLLIATRYSKPISQLM
ADTLKPSDNLYADSLYLHAAAKIKGSPVDWKQAQPVIKNFLQQQTGIDLKDSNFTDGSGL
SRYNLVTPAQTMALLKFLYQRFPLSYEYIAALPISGRDGTLQKRFKTPNQQGFVRAKTGT
MTGMNSLSGYLYTANGHTLAFAMYINRLPGKPAGPGRPLLDALCTYFLQQSPTSSRLARV
LSPHSRIKFQFNPTQIELQRVHQAKWRRLETAVRQVLRGQDVNVVYRGNELIVTDNQSNA
NSVWKALQSIGKKYSFAVALSSKVMPVTPSGKPLLLWVQAPLSENKAERTWIIREAV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggacgttgactggggcattcatgtgggcagtatggtcactgtcatctcatgcg
gctagtatgcagttcgaggtggataaattaattaatcggctaaaccctcgtgtgaacctg
gggatagtagtgaccgatctaacctcgggcgagacgctatataaacgcaatgccaatcgt
ttgtatattcctgccagcaacatgaagcttttttccgaggcagcggctctgatggccttg
ggtccagactaccagttcaagaatcaactcagtacgagcgccaatcaattacaacaaggt
gttttgcacggaaacttgtatttacatctcagcggcgatccttcgtttagcagagaagat
ttaaaggcgttgctttcttcactcaaggattggaatatcacaaccattcaaggtaatgtg
atcattgacagtagtctgatgtccattcccgcctatcccccaggctggctaacttctgat
ttatcttatagttatggtgcaccaatagcacctttgatggttgattccaaccgattaaca
atcacggtcaaccccggggctaaagcaggcgctcctgctattgttgaagtagatgatggc
ggcggtactattaacctgaataatcaagcgaccacgaaggcgagtgagaaaggatgtggt
gtagggttttatttggatcctgagaacaatttaacggtaagaggctgtgttggattaggg
caatgggctgttcagcaacgcatcgctataaagaatccttttgtttatgcccaggggatg
attgtgagtgagcttgccaagtctaatattaaattaaatggacaggttttgcttggaaga
gcgcctgctggtactttattaattgccactcgctattcaaagccaatttcccaactgatg
gcagatactttaaaaccttctgataatttatatgctgatagtttgtacttgcatgctgct
gccaaaattaagggtagtcctgtagattggaagcaagcacagccagtaattaaaaatttt
ttgcagcaacaaacaggaatcgatttaaaagactcgaattttacagatggttctggatta
tcacgttataatttggtaactccagcgcaaaccatggcgcttttaaaattcttgtatcaa
cgtttcccattatcttatgaatacattgctgctttacccatctctggtcgggatggtact
ttgcaaaaacggtttaaaaccccaaatcaacaaggatttgtgcgggccaaaaccgggacg
atgacgggtatgaacagtttatccggttacttgtatactgctaatggccatactttagct
tttgctatgtatatcaatagattacccggaaaaccggctgggccaggacgtccattatta
gacgcattatgcacttatttcttgcagcaaagcccaacaagcagtcgactggcacgggta
ttatctccccacagtcgcattaagttccaatttaatcctacacaaattgagttacagaga
gttcatcaagccaaatggaggcgtttggaaacggcagtgaggcaggtcttgagaggacag
gatgtgaatgtggtttaccggggcaatgaattaatcgtgacagacaatcagtctaatgcg
aatagcgtttggaaagctttacaatcaattggcaagaaatattcattcgccgtagccttg
tcttctaaagtgatgcctgttacaccatcgggaaaacctttgcttctttgggtgcaagca
cctttatctgaaaataaggcagagagaacctggataattcgggaagcggtataa

DBGET integrated database retrieval system