KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_00402Help
Entry
LBPG_00402        CDS       T02808                                 

Definition
(GenBank) hypothetical protein
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00340  Histidine metabolism
lpi01100  Metabolic pathways
lpi01110  Biosynthesis of secondary metabolites
lpi01230  Biosynthesis of amino acids
Module
lpi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LBPG_00402
Enzymes [BR:lpi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     LBPG_00402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: EEQ64953
LinkDB All DBs
Position
complement(1421290..1421622)
Genome map
AA seq 110 aa AA seqDB search
MTQAKQSIPALYDFIKERQANPVAGSYTDYLFTKGLDKILKKVGEESTEVIVAAKNPDDP
AFILEVADLTYHVLVLMVERGITVDQIATELASREGKKSRLQERSKIEKY
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctaagcaaagtattccagctctatatgatttcatcaaagaacgtcaagca
aatccagttgccggttcgtacacggattatcttttcaccaaaggactcgataaaatttta
aaaaaagtcggtgaagaaagcacagaagtgattgtcgccgccaaaaatccagatgatccg
gcgtttatccttgaagtggccgacctcacttatcacgtcctggttcttatggttgaacgt
ggtatcacggttgatcaaattgccaccgaattggctagtcgcgaaggaaagaagagccga
ctgcaagaacggtcaaaaatcgagaaatattaa

DBGET integrated database retrieval system