KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_00599Help
Entry
LBPG_00599        CDS       T02808                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBPG_00599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpi02000]
    LBPG_00599
Enzymes [BR:lpi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LBPG_00599
Transporters [BR:lpi02000]
 Other Transporters
  Pores ion channels [TC:1]
   LBPG_00599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_2 GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: EEQ65150
LinkDB All DBs
Position
1215406..1216035
Genome map
AA seq 209 aa AA seqDB search
MLKLFYASGTSAMAPHILLTDAGLNFELEKVNLDQKTWRGGDYDQINAKSYVPTLQIAPE
QYLTECAVILEYIDFQARQNDGSNYATDEYWQERVWLNYIATELHKNFISPFRKGNWLPN
TDDSKRLVWQRVAPRLAYVEARFQGPWLMGQHFSMTDPYLFVMTNWMHRLDFSFDHLPKL
KAFDERMRQRPSVQEVLRVEGKPHSVTDG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaattattttatgcttcaggaaccagtgcaatggcgccgcatattctactgact
gacgcgggacttaattttgagttggaaaaggtgaacttagatcaaaaaacttggcgcggt
ggcgattacgatcaaatcaacgccaagtcttatgtgccgaccttgcaaatagcgccagaa
caatacttaacagaatgcgctgtgattttagagtacattgactttcaagcccgacaaaat
gatggtagcaattatgccacagatgaatactggcaggagcgggtgtggctcaattatatt
gccacagaactccacaaaaactttatttcgccttttcggaagggtaattggctacctaat
acagatgatagcaaacggttggtgtggcagcgagttgccccgcgactagcttatgttgaa
gcacggtttcagggaccatggctaatggggcagcatttttcaatgacggatccttatctg
tttgtcatgacaaattggatgcaccggcttgatttttcatttgatcatttgccaaaatta
aaggcctttgacgagcgaatgcgacaacggccaagtgtgcaggaagttctgcgggtggaa
gggaagccgcacagcgttactgatggttaa

DBGET integrated database retrieval system