KEGG   Limnochorda pilosa: LIP_0218Help
Entry
LIP_0218          CDS       T04150                                 

Definition
(GenBank) LuxR family transcriptional regulator
Organism
lpil  Limnochorda pilosa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_23 HTH_29 HTH_7 Sigma70_ECF HTH_28 HTH_24 HTH_38 HTH_10 HTH_40 HTH_11 CtsR_C TrkA_N Colicin XFP_C
Motif
Other DBs
NCBI-ProteinID: BAS26075
UniProt: A0A0K2SG57
LinkDB All DBs
Position
230249..230899
Genome map
AA seq 216 aa AA seqDB search
MRPVRVLIVDDQQMIREGISLILKSHPGIEVVGEAANGREALERVEASQPDVVLMDISMP
ELNGIDATVVLKRRFPQVKVLALTVHDAEGYILQLLRAGASGYIVKKAAGDELIEAIRCV
CRGDYYLHPTVTRQVIEEYVRHMQEGTRGPEDLLTERERQIVQLAAEGYKNREIAERLNI
SLKTVETHRANIMQKLNISDRVELVRYAIRAGIIEP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccgtgcgcgtgctgatcgtcgatgaccagcaaatgatccgcgagggtatctcc
ctcattctcaagagccaccccggcatcgaggtggtcggtgaggccgccaacgggcgggag
gctctggaacgggtggaggcgagccagcccgacgtggtcttgatggacatcagcatgccg
gagctgaacggcatcgacgccacggtggtcttgaagcgccgcttcccccaggtgaaggtg
ctggccctcacggtccacgacgcggagggctacatcctgcagctcctgcgggcgggggcg
tcgggctacatcgtgaagaaggcggccggcgacgagctgatcgaggcgatccggtgcgtc
tgccggggcgactactacctccaccccaccgtcactcgccaggtgatcgaggagtacgtc
cgtcacatgcaggaaggcacccgcggccctgaggacctcctcaccgagcgcgagcggcag
atcgtccagctcgcggccgaagggtacaagaaccgggagatcgccgagcggctcaacatc
tccctgaagacggtggagacccaccgggccaacatcatgcagaagctgaacatctcagac
cgggtcgagttggtgcggtacgccatccgcgccggcatcatcgagccgtga

DBGET integrated database retrieval system