KEGG   Limnochorda pilosa: LIP_0270Help
Entry
LIP_0270          CDS       T04150                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00473  D-Alanine metabolism
lpil00550  Peptidoglycan biosynthesis
lpil01100  Metabolic pathways
lpil01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpil00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LIP_0270
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LIP_0270
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LIP_0270
Enzymes [BR:lpil01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LIP_0270
Peptidoglycan biosynthesis and degradation proteins [BR:lpil01011]
 Precursor biosynthesis
  Amino acid ligase
   LIP_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_Ter ATP-grasp_3 ATPgrasp_ST GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: BAS26127
UniProt: A0A0K2SGF4
LinkDB All DBs
Position
290673..291620
Genome map
AA seq 315 aa AA seqDB search
MAKPRVGVVCGGPSAEAEVSRVSGRGVAEALRATYEDVVVLELEPSISGRLQEERVDVVF
PVLHGPPGEDGCFQGLLEILGLPYVGSGVLASACAMDKVTAKRLFRASGLPVAREVVVAP
AERPAEAAERVRAELGADVVVKPARQGSAVGVGFGHDGTLEEALAQALHFGDAVLVEERV
RGKEITVAVLERDDRVEALPVIEIRTPPGSWYDYPHRYTPGWSEHVIPAPLPEATYARTQ
EVACLAHQALGCRDLSRVDFVVPDSGEPVLLEVNTIPGMTPTSLYPDAARAAGISFEQLV
AHLVERALARGGSRG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagccccgagtgggcgtggtgtgcgggggcccgtcggccgaggcggaggtctcg
agggtatcgggacgtggcgtggccgaggcgctccgggccacgtacgaggacgtggtggtc
ctggagctcgagccgtcgatctccgggcgcctgcaggaagagcgggtggacgtggtcttc
cccgtccttcacggccctccgggtgaggacggctgcttccagggtctcctggagatcctg
gggcttccctacgtgggtagcggcgtgctggccagcgcctgcgctatggacaaggtgacc
gccaagcggctcttccgggcttccgggctgcccgtggcccgggaggtggtggtggcgccc
gccgagaggccggccgaggcggcagagcgcgttcgggccgagctgggcgccgacgtggtg
gtgaaacccgcacgccagggctcggccgtgggcgttggcttcgggcacgacgggaccctg
gaggaggccctggcgcaggccctgcacttcggcgatgcagtgttggtggaggagcgggtg
cgtgggaaggagatcaccgtggccgtcctcgaacgagacgatcgggtcgaggcgctgccc
gtcatcgagatccgcacaccaccgggttcctggtacgactacccgcaccggtataccccc
ggctggagcgagcacgtcatcccggcacccctgcccgaggctacgtacgctcgaacccag
gaggtggcctgcctggcccaccaggccctgggctgccgggatctctcccgcgtcgacttc
gtggtccccgattctggggaaccagtgcttcttgaggtgaacaccatccccggtatgacg
cccaccagcctctatcccgacgccgcccgggccgcggggatctccttcgagcagctggtc
gcccatctggtcgagcgggcgctggcgcggggcgggagcagagggtga

DBGET integrated database retrieval system