KEGG   Limnochorda pilosa: LIP_0282Help
Entry
LIP_0282          CDS       T04150                                 

Definition
(GenBank) glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00730  Thiamine metabolism
lpil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LIP_0282
Enzymes [BR:lpil01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     LIP_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Thi4 NAD_binding_8 FAD_binding_2 NAD_binding_9 FAD_oxidored FAD_binding_3 Pyr_redox GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAS26139
UniProt: A0A0K2SH38
LinkDB All DBs
Position
complement(302652..303842)
Genome map
AA seq 396 aa AA seqDB search
MNETSRAGRFDAAVVGGGVVGASAAYCLSRAGLRVVLIEAGAVASGASGAAAGMLGAQLE
VEEPGPLLALALRGRRLFDTLVPALEEATGLSLGYRPEGIVRVALDEEGAQVLHATAKQQ
EALGLRARWVEAADLASVLGLPEPPRVEGAVLLEEDGQIEPEALTAALIASAPHLRLMLG
RQAVSIRPAARGWSVDLAGGASVEADRVLLATGCGSGPLLSGLGVRLSVPPVKGEMLVLQ
GPTPLRRTVFGPGAYLVPKASGRLYLGATMEPGATDTAPSLAGSRMLLDGGVRLFDALWP
GGAPGLRIAGWRVGLRPGSPDGLPILGPVPGHRGLFVATGHLRNGILLGPVSGWLLSAWM
QGSDPLVALEEATGADLPPAAHLDDLAPFLPDRLAR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagacgagccgggcaggacgtttcgacgcggcggtggtgggcggcggcgtggta
ggggcttcggccgcctactgcctgagccgggcaggcctccgggtcgtcctgatcgaagcg
ggggcggtcgcctccggcgcgtcgggggcggcggccggcatgctgggagcccagctggag
gtggaggagccagggcctctcctggctctggcgctgaggggccgccgcctcttcgacacc
ctcgttcccgcactcgaagaggcgacgggcctctcgctcgggtaccggcccgaaggcatc
gtaagggtggccctggacgaggaaggcgctcaggtcctgcacgcgaccgccaagcagcag
gaagccctggggctgcgcgcccggtgggtcgaggcggccgacctcgccagcgtcctgggg
ctcccggaaccgccccgggtcgagggggccgtgctcctggaggaggacggccagatcgag
ccggaggcgcttaccgcggcgctcatcgcgtccgcgccccacctgcgcctcatgctgggc
cgtcaggcggtatcgatccggccggcagcgaggggctggagcgtggatctggccggcggc
gcgtcggtcgaggccgatcgagtgctcttggccacagggtgtggcagcggcccgctcctg
agtggcctcggggtgcgtctctcggtacccccggtgaagggggagatgctggttctccag
ggaccgacgccgctccggcggacggtcttcggcccaggagcgtacctggtacccaaggcg
tcagggcgcctctacctgggcgccaccatggagccgggcgcgaccgacacggccccgagc
ctggcggggtcccggatgctcctggacggaggcgtgcgccttttcgacgcgctctggccc
ggcggcgcgccgggccttcgcattgcgggctggcgggtggggctcaggccagggtccccg
gacggccttcccatcctaggacccgtcccgggccacaggggcctcttcgtcgccaccggt
cacctccggaacgggatcctcctgggcccggtgagcggatggctcctgtcggcctggatg
caaggctccgacccgctcgtcgcgctggaagaggccacgggagcggatctgccgccggcg
gcccacctcgacgaccttgcgcccttcctgcccgatcgcttggcccggtga

DBGET integrated database retrieval system