KEGG   Limnochorda pilosa: LIP_2957Help
Entry
LIP_2957          CDS       T04150                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
lpil  Limnochorda pilosa
Pathway
lpil02020  Two-component system
lpil02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LIP_2957
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    LIP_2957
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lpil01001]
    LIP_2957
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lpil02022]
    LIP_2957
   02035 Bacterial motility proteins [BR:lpil02035]
    LIP_2957
Enzymes [BR:lpil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LIP_2957
Protein kinases [BR:lpil01001]
 Histidine kinases
  CheA family [OT]
   LIP_2957
Two-component system [BR:lpil02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   LIP_2957
Bacterial motility proteins [BR:lpil02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LIP_2957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW P2 HATPase_c Hpt H-kinase_dim HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: BAS28786
UniProt: A0A0K2SNV7
LinkDB All DBs
Position
complement(3128878..3130983)
Genome map
AA seq 701 aa AA seqDB search
MSVGEERALFLSESHEYLDLLNRGLLQLDAGTDPQVVDELFRAAHSLKGMAATLGEQAVV
GLTHAMEEFFSRLRETGERLTPDDLDLLLSSCDGLEAWLVANEQGDGTEMERAARELGDL
EARVRSGFAGLVARDAQEQASEAARTPPSNGLAGRKPAAGATEGAVTGRPDGPALELDLY
DEEILREAARRGLGATDLLVRLHPDCRMKSVRVFLIFRNLEQVGEIVKSVPPAQALDEER
FDDTFRLLVISSEPPEALAARVNGVADVREAVARRVEAPPETEAAPRAHGNGTAPPPVGA
REGGPGAAREPGAVRDTFLNERSLRVDVGRLDQLVNLVGELVIQRNRLLSVAEESGLARE
VVEGIDRVSTDLQAGVMALRMVPLRFIFQRFPRMVRDLARSLGRQVELEMEGEETELDRS
LIHSLADPLIHLIRNAIDHGIERPAERVRRGKPAAGRLAVAARQEGNRVVIEVADDGAGI
DAAAIRRRLVERGLLTQAEVDELSDRQALDWIFRPGFSTAAQVSDVSGRGVGMDVVRAAV
EGAGGGLQVTSEPGRGTRVRLELPLTLAIIQALLVEVAGETLALPMDVVSEVLRTGDADI
RRMRAGTVLNWRGAVLPVIALDERLRLRASNGEPPMEGLALVLERAGRSVCCLVDEVVGH
QEVVIKPLSRVMRALPEVAGATVLGSGRVAVILNPETWLEG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttggcgaggagcgtgcgctcttcctgagcgagagccacgagtacctggacctg
ctcaaccgggggctcctgcagctggacgccggcaccgaccctcaggtggtggacgagctc
ttccgggccgcccacagcctcaaggggatggccgccaccctgggcgagcaggcggtggtg
gggctcacgcatgccatggaggagttcttcagccgcctgcgggagacgggcgagcggctc
acccccgacgacctggacctcctcctctccagctgcgacgggctcgaagcgtggctggtg
gcgaacgagcagggcgacgggacggagatggagcgggcagcccgggaattgggcgacctg
gaggcacgcgtccgctcgggcttcgccgggctggtcgcccgggacgcgcaggaacaagca
agcgaggccgccaggaccccgccgtccaacggtctggcggggcgcaagccggccgccggc
gcgaccgagggcgccgtcaccggccgcccggatgggcccgcgctcgaactggacctctac
gatgaagagatcctgcgggaggcggcgcggcggggcctgggtgcaacggacctgctcgtg
cgcctccacccggactgccggatgaagtccgtccgggtcttcctgatcttccggaacctg
gagcaggtgggcgagatcgtgaaatcggtgcccccggcccaggccctggacgaggagcgc
ttcgacgacaccttccggcttctggtgatctcctcggagccgcccgaggcgctggcggcc
cgggtgaacggtgtcgccgacgtgcgcgaggccgtcgcccgccgggtggaggcgcccccg
gagacggaggccgccccgcgtgcgcacgggaacgggacggcgcccccgcccgtgggggcc
cgcgagggaggcccgggagccgcccgagagcctggagcggtgcgggacaccttcctcaac
gagcgctccctccgggtggacgtgggacgcctggatcagctcgtgaacctggtgggcgag
ctggtcatccagcggaaccgcctcctcagcgtggctgaggagagcgggctggcccgggag
gtggtggaggggatcgaccgggtctccacggacctccaggccggcgtgatggcccttcgc
atggttccgctccgcttcatcttccagcgctttccccgcatggtgcgcgacctggcccgg
agcctgggccggcaggtggagctcgagatggagggcgaggagacggagctggaccggtcg
ttgatccactccctcgcggacccgctcatccacctgatacggaacgcgatcgaccacggc
atcgagcgacccgccgagcgggtccggcgcggcaagcctgctgccggccggctggccgtg
gccgcccggcaggaggggaaccgggtggtcatcgaggtggctgacgacggtgccgggatc
gacgcagctgcgatccgccgccggctggtggagcgggggttgctcacccaggcggaggtc
gacgagctctcggaccggcaggccctggactggatcttccgccccggtttctccaccgcc
gcgcaggtgagcgacgtctcgggccggggcgtggggatggacgtggtccgggccgcggtg
gagggcgcgggcggcggcctccaggtgacctcggagcccgggcggggcacccgggtgcgg
ctggagctccctctcaccctggccatcattcaggccctgctggtggaggtggctggcgag
accctcgccctgcccatggatgtggtctcagaggtgctgcggaccggcgatgcggacatc
cgccggatgcgggccgggacggtactcaactggcgcggcgcggtgctgccggtgatcgcc
ctggatgagcgcctccggctgcgggcgtccaacggcgagccgcccatggagggtctggcc
ctggtgctggagcgggcggggcggagcgtctgctgcctggtggacgaggtggtcggccac
caggaggtggtgatcaagccgctgagccgggtcatgcgggctctgccggaggtggccggg
gcgaccgtcctggggagcgggcgagtggcggtcatcctcaacccggagacgtggctggag
gggtag

DBGET integrated database retrieval system