KEGG   Limnochorda pilosa: LIP_2971Help
Entry
LIP_2971          CDS       T04150                                 

Definition
(GenBank) anti-sigma-28 factor FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
lpil  Limnochorda pilosa
Pathway
lpil02020  Two-component system
lpil02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LIP_2971
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    LIP_2971
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:lpil02035]
    LIP_2971
Bacterial motility proteins [BR:lpil02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    LIP_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM YscO-like HTH_29 HTH_32
Motif
Other DBs
NCBI-ProteinID: BAS28800
UniProt: A0A0K2SNV8
LinkDB All DBs
Position
complement(3140651..3141001)
Genome map
AA seq 116 aa AA seqDB search
MIVSEAQVQRVVRIYQVQGAQKVKAGPGGGRPRPDRVTLSKEAREIQKVREALAGMPDVR
EAKVAELRKALDAGTYRVDSADVAEKMFARFLVDRLAADLPSTQDAEGAPGGREGD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtctccgaggcgcaggtccagcgggtggtccgtatctaccaggtgcagggcgcg
cagaaggtgaaggcgggcccgggcggcggccggccccgtcccgacagggtcaccctgtcc
aaggaggcccgggagattcagaaggtccgggaagccctggcggggatgcccgacgtgcgg
gaagcgaaggtggccgagctgcggaaggccctggacgccggaacctatcgtgtcgactcg
gccgacgtggccgagaagatgttcgcccgattcctggtggaccgtttggccgcggacctg
ccgtccacccaggacgcagagggtgcccccggtggcagggagggagactga

DBGET integrated database retrieval system