KEGG   Limnochorda pilosa: LIP_2991Help
Entry
LIP_2991          CDS       T04150                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00220  Arginine biosynthesis
lpil00250  Alanine, aspartate and glutamate metabolism
lpil00270  Cysteine and methionine metabolism
lpil00330  Arginine and proline metabolism
lpil00350  Tyrosine metabolism
lpil00360  Phenylalanine metabolism
lpil00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpil00401  Novobiocin biosynthesis
lpil01100  Metabolic pathways
lpil01110  Biosynthesis of secondary metabolites
lpil01130  Biosynthesis of antibiotics
lpil01210  2-Oxocarboxylic acid metabolism
lpil01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LIP_2991
   00270 Cysteine and methionine metabolism
    LIP_2991
   00220 Arginine biosynthesis
    LIP_2991
   00330 Arginine and proline metabolism
    LIP_2991
   00350 Tyrosine metabolism
    LIP_2991
   00360 Phenylalanine metabolism
    LIP_2991
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIP_2991
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    LIP_2991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpil01007]
    LIP_2991
Enzymes [BR:lpil01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     LIP_2991
Amino acid related enzymes [BR:lpil01007]
 Aminotransferase (transaminase)
  Class I
   LIP_2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 OKR_DC_1 Radical_SAM Trp_syntA
Motif
Other DBs
NCBI-ProteinID: BAS28820
UniProt: A0A0K2SNX7
LinkDB All DBs
Position
3163608..3164804
Genome map
AA seq 398 aa AA seqDB search
MELARRIDRIEPSPTLAMSARARALTQQGVDVVDLGVGEPDFDTPEPIKEAAVRALRDGR
TKYTASAGIPELREAIAQKLRRENGLPYAREDVLVTVGAKHAVYLALQALCNPGDRVLLP
APYWVSYAEQVRLVDAEPVFLPTREEDGFKLTPETLAAHVAGARALILNSPNNPTGAVYT
PQELGALGEVLDREPGCWLLSDEIYEPFVYDGARHASLLALRPELRERAVLIHGFSKTYA
MTGWRLGYAAGPRPLVAAMVNLQSHSTSNATSFAQVAAVEALQGSQRPVEEMVRVFQQRR
DLLLSGLARLPGLRCTRPAGAFYLFPNVSGVFGRSYRGEVVHGSQDLAERLLDGVATATV
PGTAFGTEGYLRLSYAASTERLEEGLHRLNAFWEETEP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtggaactggcccgcaggatcgaccggatcgaaccctcccccaccctggccatgagcgcc
cgggcccgcgccctcacgcagcagggcgtggacgtggtcgacctcggcgtgggcgagccc
gacttcgacacgcccgagccgatcaaggaggccgccgtccgcgccctccgcgacggccgg
accaagtacacggcctcggccgggatccccgagctgcgagaggccattgcgcagaagctc
cggcgggagaacggcctgccctacgcccgggaggacgtgctggtgacggtgggggccaag
cacgccgtctacctggccctgcaggccctctgcaacccgggcgaccgggtgctccttccc
gccccctactgggtgagctacgcggagcaggtgcgcctggtggacgccgagcccgtcttc
ctgcccacccgggaggaggacggtttcaagctcaccccggagaccctggcggcccacgtc
gccggcgccagggcgctgatcctgaactcgcccaacaacccgacgggcgcggtctacacg
ccccaggagctcggagccctgggcgaggtgctggatcgggagccgggctgctggctcctc
tccgacgagatctacgaacccttcgtctacgacggcgcccgccacgcaagcctcctcgcg
ctccgtcccgagctgcgggagcgcgcggtcctcatccacggtttctccaagacgtacgcc
atgaccggctggcggctgggctacgcggcggggccccggcccctggtggcggccatggtc
aacctccagagccactccacctccaacgccacctccttcgcccaggttgccgccgtggag
gcgctccagggctcgcagaggccggtggaggagatggtgcgggtcttccaacagcggcgg
gacctgctcctgtcgggcctggcgcggctccccgggctccgctgcacccgccccgcggga
gctttctacctctttcccaacgtgtcgggggtcttcggccggtcttaccggggtgaggtc
gtgcacggcagccaggacctggccgagcgattgctggacggcgtggccaccgccaccgtg
cctgggaccgccttcggcaccgagggctacctgcggctctcgtacgcagcctccaccgag
cgcctggaggagggccttcatcggctgaacgccttctgggaggagactgaaccatga

DBGET integrated database retrieval system