KEGG   Limnochorda pilosa: LIP_3424Help
Entry
LIP_3424          CDS       T04150                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
lpil  Limnochorda pilosa
Pathway
lpil00630  Glyoxylate and dicarboxylate metabolism
lpil01100  Metabolic pathways
lpil01120  Microbial metabolism in diverse environments
lpil01200  Carbon metabolism
Module
lpil_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:lpil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LIP_3424
Enzymes [BR:lpil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LIP_3424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAS29236
UniProt: A0A0K2SQ66
LinkDB All DBs
Position
3598149..3598496
Genome map
AA seq 115 aa AA seqDB search
MPSRRTELFSYLPPLSDDQAARQVRYMLDRQLMPGIEYTARLDPSDDYWHFWKLPFFQVS
DPAEVMAELKACRRDHPEAFIRLTGYDPQRQCQVVSFVLHRPDAPEPQEGSSCTS
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtcccggcgcaccgagctcttctcctacctgccgcccctgagcgacgaccaggcg
gcccggcaggtgcggtacatgctggaccgccagctcatgccgggcatcgagtacacggcc
cggttggacccgtccgacgactactggcacttctggaagctgcccttcttccaggtttcc
gacccggcagaggtgatggccgagctgaaggcctgccgccgggaccatccagaggccttc
atccgcctcaccggatacgacccgcagcggcagtgccaggtggtgagcttcgtccttcac
cggcccgatgcccccgagccacaggagggatcctcgtgcacgagctga

DBGET integrated database retrieval system