KEGG   Lactobacillus plantarum JDM1: JDM1_0006Help
Entry
JDM1_0006         CDS       T00946                                 

Gene name
gyrA
Definition
(GenBank) DNA gyrase, A subunit
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
lpj  Lactobacillus plantarum JDM1
Brite
KEGG Orthology (KO) [BR:lpj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lpj03032]
    JDM1_0006 (gyrA)
   03400 DNA repair and recombination proteins [BR:lpj03400]
    JDM1_0006 (gyrA)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     JDM1_0006 (gyrA)
DNA replication proteins [BR:lpj03032]
 Prokaryotic type
  DNA Topoisomerases
   JDM1_0006 (gyrA)
DNA repair and recombination proteins [BR:lpj03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      JDM1_0006 (gyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: ACT60895
LinkDB All DBs
Position
6676..9237
Genome map
AA seq 853 aa AA seqDB search
MADSDLSNNRISDVNLSKTMRTSFLSYAMSVIVARALPDVRDGLKPVHRRILYGMSELGV
TPDKPYKKSARIVGDVMGKYHPHGDSAIYESMVRMAQDFSYRYMLVDGHGNFGSVDGDGA
AAMRYTEARMSKIAVEMLRDINKDTVDWQPNYDDTEREPAVLPARFPNLLVNGATGIAVG
MTTNIPPHNLAEVISAIHLLMDNPDATVADLMEVLPGPDFPTGGIVMGKSGIRKAYQTGR
GNIIVRAKVDIQDQKNGKQRIIVTELPYMVNKAKLIERIAGLARDKEIEGITDINDESDR
EGMRIVIDVRRDASASVILNNLYKMTLMQTNFGFNMLAIVKGAPKVLSLKQILIYYLEHQ
EDVIRRRTEFDLKKAQARAHILEGLRIALDHIDEIIAIIRQSQTSEIAKNQLMDNYGLSD
KQAQAILDMRLVRLTGLEREKIESEYQDLLKAIADYKEILASKDRINQIIYEELMEIQRK
FGDKRRTELMVGEVLSIEDEDLIEEEEVAVTLTHNGYIKRLPTTEFKSQHRGGRGIQGMD
VHDDDFIEHLLTTSTHDVLLFFTNAGKVYRMKAYEIPEYGRTAKGIPVINLLGVNSGEKI
QAVVNVTGDASASDNYLFFTTVKGVVKRTPVQEFANIRSNGLKAITLKDDDELIGVTITD
GHQNIIIGTHDGYAVSFDETTVRSMGRTASGVRGIRLRDDDFVIGFDVLKPDSNVFIITE
KGYGKQTPAADYPIKGRGGKGIKTANVTEKNGHLAGLTTVDGQEDIMVMTNQGVMIRFNI
ATVSQTGRATLGVRLMRLGDDGQVATMAKVDPEPEVDETVATDATTEAPVDDQTVNADAT
TTEPTTDSNDSNE
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
ttggctgattcagatttatcgaacaatcgtatttcggatgtgaacctttcgaagaccatg
cgaacgtcattcttaagctatgccatgagtgttatcgtggcacgggcactgccggacgta
cgtgatgggttaaagccagtgcaccggcggattctttacggtatgagtgaattaggtgtg
acgccggataagccgtataagaagtcggcccggattgttggggatgttatggggaagtat
catccccatggtgactccgcaatttatgagtcaatggtgcggatggcccaagactttagc
tatcgctacatgttagtggatggtcacgggaacttcggttctgtcgatggtgacggggct
gccgcgatgcggtataccgaagcccggatgagtaagattgcggttgaaatgctccgcgat
attaacaaggataccgttgattggcaaccaaactatgatgatacagaacgggaaccagca
gtcttaccagcacgtttcccgaacttactcgttaacggtgccactgggattgctgttggg
atgacaacaaacattccgccacataacttagcggaagtcatttcagcaatccacttgttg
atggataatcctgatgcaacagttgctgacttgatggaagtcttacctggaccagatttt
ccaactggcgggatcgtaatgggaaagtccggtattcgtaaggcttaccagactggtcgt
gggaacattattgttcgtgcgaaggtcgatattcaagaccaaaagaatggtaagcaacga
attatcgtgaccgaattgccatatatggtcaataaagctaaattgatcgaacggattgct
ggtttagctcgagacaaggaaattgaaggtatcactgatatcaatgatgaaagtgaccgt
gaagggatgcggatcgtcattgatgttcggcgggatgccagcgcctcggttatcttgaat
aacctttacaagatgacattgatgcagactaactttggctttaacatgttagccatcgtt
aagggtgctccaaaagtcttaagcttaaagcaaatcttaatctattacctggaacaccag
gaagacgtgattcggcgtcggactgagtttgacttgaagaaagcccaagcacgggcccat
attcttgaaggcttacggattgcccttgatcacattgatgaaatcattgcgattattcgt
caatcacaaacgagtgaaattgcgaagaaccaattgatggataattacggcttgtctgat
aagcaggcacaagccattcttgatatgcggttagtccggttaactggtttggaacgtgaa
aagatcgagagtgaataccaggacttattgaaagccattgctgactacaaagaaatctta
gctagcaaggatcgtatcaaccaaattatttacgaagaattaatggaaattcaacgtaag
tttggtgataagcgtcggaccgaattgatggtcggtgaagtcctcagtattgaagatgaa
gacttgatcgaagaagaagaagtggctgttaccttaactcacaatggctacatcaaacgg
ttaccaacgactgaatttaagtcgcaacaccgtggtggtcgtgggattcaagggatggac
gtccatgatgatgactttattgaacatctactgacgacgtcgacccatgatgtcctactc
tttttcactaatgcgggtaaagtttaccggatgaaggcttacgagattcctgaatacggt
cgtacggccaaaggaatcccggtcatcaatttattgggagtcaattctggtgaaaaaatt
caggcggtcgttaatgtcacgggcgacgcgagcgcttctgataactacctgttctttaca
accgttaaaggggttgtcaaacggacaccagttcaagaatttgccaatatccgaagcaat
ggtttgaaggccattacgcttaaggatgatgatgaattaatcggggttacaatcacggat
ggtcaccaaaatataatcatcgggacgcacgacggttatgctgtcagtttcgacgaaacc
acggtgcggtccatgggccggacggcttctggggttcgcgggattcgcttacgcgatgat
gactttgtgattggctttgacgttttgaagcccgacagcaacgtcttcatcatcacggaa
aagggttatgggaaacaaacgccagctgccgattacccaattaaggggcgtggtggcaaa
ggaattaagaccgctaacgtgactgagaagaatggtcatttagctggtttgacgacggtt
gatggtcaagaagatatcatggtaatgacgaaccaaggagtcatgattcgcttcaatatc
gcaaccgtttctcagactggtcgggcaaccttaggtgttcgtctcatgcggttaggcgat
gatggtcaagtcgcaacgatggccaaggttgatccagagccagaagttgatgagactgtc
gcaacggatgcaacgactgaggcaccagttgacgatcaaaccgtcaacgccgatgccact
acgacagaaccaacaactgattcaaacgattcaaacgaataa

DBGET integrated database retrieval system