KEGG   Lactobacillus plantarum JDM1: JDM1_2723Help
Entry
JDM1_2723         CDS       T00946                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00250  Alanine, aspartate and glutamate metabolism
lpj00430  Taurine and hypotaurine metabolism
lpj00650  Butanoate metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JDM1_2723 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JDM1_2723 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JDM1_2723 (gadB)
   00430 Taurine and hypotaurine metabolism
    JDM1_2723 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JDM1_2723 (gadB)
Enzymes [BR:lpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     JDM1_2723 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACT63609
LinkDB All DBs
Position
2929549..2930958
Genome map
AA seq 469 aa AA seqDB search
MAMLYGKHNHEAEEYLEPVFGAPSEQHDLPKYRLPKHSLSPREADRLVRDELLDEGNSRL
NLATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPDDEHFTG
TSTIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAHRPNLVISAGYQVCWEKFCVYWDVDM
HVVPMDEQHMALDVNHVLDYVDEYTIGIVGIMGITYTGQDDDLAALDKVVTHYNHQHPKL
PVYIHVDAASGGFYTPFIEPQLIWDFRLANVVSINASGHKYGLVYPGVGWVVWRDRQFLP
PELVFKVSYLGGELPTMAINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLAAA
LDKVGEFKMINNGHQLPLICYQLAPREDREWTLYDLSDRLLMNGWQVPTYPLPANLEQQV
IQRIVVRADFGMNMAHDFMDDLTKAVHDLNHAHIVYHHDAAPKKYGFTH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttatacggtaaacacaatcatgaagctgaagaatacttggaaccagtcttt
ggtgcgccttctgaacaacatgatcttcctaagtatcggttaccaaagcattcattatcc
cctcgagaagccgatcgcttagttcgtgatgaattattagatgaaggcaattcacgactg
aacttggcaactttttgtcagacctatatggaacccgaagccgttgaattgatgaaggat
acgctggctaagaatgccatcgacaaatctgagtacccccgcacggccgagattgaaaat
cggtgtgtgaacattattgccaatctgtggcacgcacctgatgacgaacactttacgggt
acctctacgattggctcctctgaagcttgtatgttaggcggtttagcaatgaaattcgcc
tggcgtaaacgcgctcaagcggcaggtttagatctgaatgcccatcgacctaacctcgtt
atttcggctggctatcaagtttgctgggaaaagttttgtgtctactgggacgttgacatg
cacgtggtcccaatggatgagcaacacatggcccttgacgttaaccacgtcttagactac
gtggacgaatacacaattggtatcgtcggtatcatgggcatcacttataccggtcaagat
gacgacctagccgcactcgataaggtcgttactcactacaatcatcagcatcccaaatta
ccagtctacattcacgttgacgcagcgtcaggtggcttctataccccatttattgagccg
caactcatctgggacttccggttggctaacgtcgtttcaatcaacgcctccggacacaag
tacggtttagtttatcccggggtcggctgggtcgtttggcgtgatcgtcagtttttaccg
ccagaattagtcttcaaagttagttatttaggtggggagttgccgacaatggcgatcaac
ttctcacatagtgcagcccagctcattggacaatactataatttcattcgctttggtatg
gacggttaccgcgagattcaaacaaagactcacgatgttgcccgctacctggcagccgct
ctggataaagttggtgagtttaagatgatcaataacggacaccaactccccctgatttgt
taccaactagccccgcgcgaagatcgtgaatggaccctttatgatttatcggatcgccta
ttaatgaacggttggcaagtaccaacgtatcctttacctgctaatctggaacaacaagtc
atccaacgaatcgtcgttcgggctgactttggcatgaatatggcccacgatttcatggat
gacctgaccaaggctgtccatgacttaaaccacgcccacattgtctatcatcatgacgcg
gcacctaagaaatacggattcacacactga

DBGET integrated database retrieval system