KEGG   Lactococcus piscium: LACPI_0185
Entry
LACPI_0185        CDS       T03909                                 

Gene name
levD
Definition
(GenBank) Fructose-specific phosphotransferase enzyme IIA component LevD
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
lpk  Lactococcus piscium
Pathway
lpk00051  Fructose and mannose metabolism
lpk02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LACPI_0185 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LACPI_0185 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpk02000]
    LACPI_0185 (levD)
Enzymes [BR:lpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     LACPI_0185 (levD)
Transporters [BR:lpk02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    LACPI_0185 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: CEN27385
UniProt: A0A0D6DV55
LinkDB
Position
I:201031..201474
AA seq 147 aa
MTAIIVSGHGQLSTGLLDAFEMIFGHDDKIIAVPFLKGEGIPQLQDKYQAVMAKFPDEPI
LFLVDVFGGTPYNSAVQLVFNNPLADVVTGVNLPMLLEIAAIKEFSDLDALKQQLKLINQ
EGFKIFSEVINAAKTTDPIDDEEDDLL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgacagcaattattgtcagtgggcatggtcaattgtcaacaggcttactagatgctttt
gaaatgatttttggtcatgacgataaaattatcgctgtaccgtttttaaaaggtgaaggg
attccgcaacttcaagacaagtatcaagctgtaatggctaagtttccagatgaacccatt
ttatttttagtagacgtgtttggtggcacaccttataactcagcagtgcaactggtgttc
aataacccactagcagatgttgtgacaggtgttaacttacccatgttactcgaaatcgca
gcaattaaagaattcagtgacttagatgcgcttaagcagcagctaaaactgatcaaccaa
gaaggctttaagatcttctcggaagtcattaacgcagctaagaccacagaccctatagat
gatgaagaggatgatttattatga

DBGET integrated database retrieval system