KEGG   Lactococcus piscium: LACPI_0187
Entry
LACPI_0187        CDS       T03909                                 

Gene name
levF
Definition
(GenBank) Fructose permease IIC component LevF
  KO
K11196  fructose PTS system EIIC component
Organism
lpk  Lactococcus piscium
Pathway
lpk00051  Fructose and mannose metabolism
lpk02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LACPI_0187 (levF)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LACPI_0187 (levF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpk02000]
    LACPI_0187 (levF)
Transporters [BR:lpk02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    LACPI_0187 (levF)
SSDB
Motif
Pfam: EII-Sor HRG
Other DBs
NCBI-ProteinID: CEN27387
UniProt: A0A0D6DU21
LinkDB
Position
I:202008..202802
AA seq 264 aa
MSVIQIVLLLIVAAITGIGSVVDEAQTHRPLVACTLVGIVLGDIPTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVINSHQGIGQGIAIAVPLAAAGQALTIFVRTITVFFIH
KADDMAKKGNYKGIERAHLLAMSLQALRVMIPTLIICLISATAVQHFLSSIPEVITRGLQ
IGGGIIVVVGYAMVINMMDVPYLKPFMYAGFLFAAFTNFNLVGFGALGLIAALIYLQLKY
NNQPQTAVTPAGVVFDDDDDDLDA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagtgtcattcaaattgtattattactaattgttgcggcaattactggtattggatca
gtagtagatgaagcacaaacacatcgcccattggttgcttgtacattagtcgggattgtt
ttaggagatattccaactgggattatcctcggtgggacactagagatgatggctttgggc
tggatgaacgttgggcttgctatggcacctgatacagcaatcgcctcagttatctccact
atccttgtgattaattcacaccaagggattggtcaagggattgcgattgcagttcccctt
gcagcagctggtcaagctttgacaatttttgttagaacgattactgtattttttattcat
aaagctgacgatatggccaaaaaaggcaattacaaagggattgaacgtgcccacttgcta
gccatgagtttgcaggccctacgtgtcatgattccaaccttgattatttgtttaatctct
gcaactgctgtacaacatttcctaagttctattccagaagtcatcacaagaggtctacaa
atcggtggtggtatcatcgttgttgttgggtacgccatggtgattaacatgatggatgtc
ccttacttgaaaccgttcatgtacgcaggtttcctatttgcagcctttaccaacttcaac
cttgttggctttggtgccttaggcttaatcgcagcattgatctacctacaattaaaatac
aataatcaaccacaaacggctgtcacaccagcaggtgtcgtgtttgatgatgacgatgac
gacttagacgcatag

DBGET integrated database retrieval system