KEGG   Lactococcus piscium: LACPI_0317Help
Entry
LACPI_0317        CDS       T03909                                 

Gene name
alaA
Definition
(GenBank) Glutamate-pyruvate aminotransferase AlaA
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lpk  Lactococcus piscium
Pathway
lpk00220  Arginine biosynthesis
lpk00250  Alanine, aspartate and glutamate metabolism
lpk00290  Valine, leucine and isoleucine biosynthesis
lpk01100  Metabolic pathways
lpk01110  Biosynthesis of secondary metabolites
lpk01130  Biosynthesis of antibiotics
lpk01210  2-Oxocarboxylic acid metabolism
lpk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LACPI_0317 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    LACPI_0317 (alaA)
   00220 Arginine biosynthesis
    LACPI_0317 (alaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpk01007]
    LACPI_0317 (alaA)
Enzymes [BR:lpk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LACPI_0317 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     LACPI_0317 (alaA)
Amino acid related enzymes [BR:lpk01007]
 Aminotransferase (transaminase)
  Class I
   LACPI_0317 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CEN27517
UniProt: A0A0D6DUC9
LinkDB All DBs
Position
I:322874..324088
Genome map
AA seq 404 aa AA seqDB search
MSTFEKSSKLEHVAYDIRGPVLDEANRMRANGEKILRLNTGNPAEFGFTAPDEVLRDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLHGFPNVDVNDIYTGNGVSELIAMAMNGLLNTGD
EVLIPMPDYPLWTASVSLAGGHAVHYLCDEGAEWYPDIADIKSKITSNTKAIVIINPNNP
TGAVYPRDILLDIVEVARQNDLIIFSDEIYDRIIMDGIKHIPIASLAPDLFVVTMNGLSK
SHRVAGFRVGWMVLSGDKSRARGYIEGLDMLANMRLCSNVLAQQVIQTSLGGTQSVDELL
LPGGRIYEQREFIYKAMNEIPGISAVKPKAAFYIFPKIDTARYNIHNDEQFVLDFLKQEK
IMLVHGRGFNWKDPDHFRIVYMPRVDELAVIQEKMTRFLHKYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatttgaaaaatcgagtaaattagaacatgtagcctatgatattcgtggccct
gttttagatgaagctaaccgcatgcgtgcaaatggcgaaaagattctacggttaaataca
ggcaatccagcagagttcggcttcactgcgcccgatgaagtacttagagatctgattatg
aatgcacgtgatagtgaaggctattccgacagcaaaggtatctttagtgcccggaaagca
atcatgcaatattgccaattgcatggctttccaaatgtagatgttaatgatatctataca
ggtaatggtgtgagtgagttaattgccatggccatgaatgggcttttgaatacaggagat
gaagtcctgatacccatgcctgactatccgctttggacagcatctgttagtttagcaggt
gggcatgcggttcattatctgtgtgatgaaggggctgagtggtatccggatattgcagat
attaaatcaaaaattacttccaataccaaagccatcgtcatcattaatcctaataatcca
acgggtgcggtctatccacgtgatattctactagacattgttgaagttgcccgtcaaaat
gacttgattatcttttcagatgagatctatgaccggattattatggatggtatcaaacat
attcccattgctagcttagcaccagatttatttgtcgtgacgatgaatggcttatcaaaa
tcgcaccgtgtagctggatttcgtgttgggtggatggtgctttcaggagacaaaagtcgc
gctagaggctatatagaaggtctagatatgctagctaatatgcgtttgtgctcaaatgtc
ttggcacagcaagtcatccaaacctctctcggtgggacacaatccgtggatgaactcttg
ttaccgggaggtcgcatctatgagcaacgtgaatttatctataaggccatgaatgaaatt
ccaggaatttcagcagttaagcctaaggcagcattctatatttttcctaaaatcgacacg
gcgagatataatatccataacgatgaacaatttgtcttagatttcctcaaacaagagaag
attatgctggtccatggccgcggctttaattggaaagatcctgaccatttccgtattgtt
tatatgccacgagtagacgaacttgctgttattcaagagaaaatgacacgcttcttacat
aagtatcgtcagtaa

DBGET integrated database retrieval system