KEGG   Lactococcus piscium: LACPI_0321Help
Entry
LACPI_0321        CDS       T03909                                 

Gene name
gatA
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lpk  Lactococcus piscium
Pathway
lpk00970  Aminoacyl-tRNA biosynthesis
lpk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LACPI_0321 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lpk03029]
    LACPI_0321 (gatA)
Enzymes [BR:lpk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LACPI_0321 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LACPI_0321 (gatA)
Mitochondrial biogenesis [BR:lpk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LACPI_0321 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CEN27521
UniProt: A0A0D6DUT8
LinkDB All DBs
Position
I:327392..328834
Genome map
AA seq 480 aa AA seqDB search
MTTIKSLHDQLVNKEISAVELTKATLKNMTDREGKVDSFITITEAQALAQAAAIDARGID
AANPVSGIPLAVKDNISTNGILTTAASKMLYNYTPIFDATAVEKLYSNDMIVVGKTNMDE
FAMGGSTENSAFKATKNAWDQTKVPGGSSGGSATAVAANQVLLSLGSDTGGSIRQPASFN
GVVGMKPTYGRVSRFGLIAFGSSLDQIGPFSQNVTDNALLLNAISGHDPKDSTSSKVAVP
DFSSKIGQDIKGLKIALPKEYLGEGIDPKVKEQVLAAAKHFEKLGATVEEVSLPHSKYGV
AVYYIIASSEASSNLQRFDGIRYGFRAEDAVDLEDIYVKTRSQGFGEEVKRRIMLGTFSL
SSGYYDAYFKKAGQVRTLIMQDFQKVFENYDLIIGPTAPSVAYDLDTQGHDPVAMYLADL
LTIPVNLAGLPGISIPAGQVEGLPVGLQIIGKAFDEATIYQAAAAFEATTDFHKAKPLIF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgattaaatcactccatgaccaattggtcaacaaggagatttcagcagttgag
ttaacaaaagcaaccctgaaaaatatgacagatcgtgaaggcaaagtagatagctttatc
acgattacagaagcgcaagcacttgcacaagcagcggctatcgatgcacgtgggattgat
gcagctaacccagtatctggtattcctttagcggttaaagataatatctcaactaatggg
atcttaacgactgcagcctctaaaatgctctataactatacgcctattttcgatgcaaca
gctgtcgaaaaactgtatagtaatgacatgatcgtggttggtaaaaccaatatggatgag
tttgctatgggtggctcaactgagaattcagcctttaaagcaactaaaaatgcatgggat
caaactaaagtacctggtgggtcatctggtgggtctgcgacagctgttgcagccaatcaa
gtcttgctatcacttgggtctgatacaggtgggtcaatccgccaacccgcatcatttaat
ggtgttgttgggatgaaaccaacctatggtcgtgtttcgcgttttggcttgattgcattt
gggtcatcacttgaccaaattggtccattttctcaaaatgtgacagacaatgccttgtta
cttaatgcgatttcaggtcatgatcctaaggattcaacctcttcaaaagtggctgtgcct
gatttttcatcaaaaattggtcaagacattaaaggccttaagattgccttgcctaaagaa
tacttaggtgaaggaattgatccaaaggttaaagaacaagtcttagctgcagccaaacac
tttgaaaagcttggggcaacggttgaagaagttagtctcccacatagtaaatacggcgta
gctgtctactacatcattgcgtcatcagaagcaagttctaacttgcaacgctttgatggg
attcgttatggcttccgtgctgaggatgcggtcgatttagaagatatttacgttaaaaca
cgttcacaaggttttggtgaagaagttaaacgtcgaatcatgctagggacatttagtttg
tcatctggttattacgatgcttactttaaaaaagcaggtcaagtcagaaccttgatcatg
caagacttccaaaaagtatttgaaaactatgacttaatcatcggcccaacagcaccaagt
gtcgcttatgatttggatacacaaggtcatgatccagttgccatgtacttagccgatttg
ttaacgattcctgtcaacttagctggactaccaggtatttcaattcctgcaggtcaggtt
gaaggattgccagttggtttgcaaatcattggtaaagcgtttgatgaagctacaatttat
caagcagctgcagcttttgaagcgactacagacttccataaagccaaaccacttatcttt
taa

DBGET integrated database retrieval system