KEGG   Lactobacillus plantarum WCFS1: lp_0773
Entry
lp_0773           CDS       T00115                                 

Gene name
uvrA1
Definition
(RefSeq) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    lp_0773 (uvrA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_0773 (uvrA1)
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     lp_0773 (uvrA1)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      lp_0773 (uvrA1)
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase AAA_23 AAA_21 AAA_22 AAA_33 AAA_25 DnaJ_CXXCXGXG APS_kinase DUF2075 AAA_14 AAA_18 Viral_helicase1 Cytochrome_C7 cobW NACHT T2SSE Cytochrom_c3_2 MMR_HSR1 RNA_helicase AAA_24 RNA12 MeaB NTPase_1 Septin
Other DBs
NCBI-GeneID: 1063752
NCBI-ProteinID: YP_004888750
UniProt: Q88YI7
LinkDB
Position
707211..710066
AA seq 951 aa
MANDKIVIHGARAHNLKDIDVTIPRDKLVVITGLSGSGKSSLAFDTLYAEGQRRYVESLS
AYARQFLGQMQKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTEINDYLRLLWARVGEP
ICPNDGTPIASQTVEQMVDRIQKLPERTKLQILSPIVRQKKGEHKKIFEKIKREGFVRVR
VDGDIHDISETFELNKNQQHTIEIVIDRIVVKSGDRSRLFDSFEAALRLSGGYAIADVIG
GEPIMFSEHYACPICGFTVGELEPRLFSFNAPQGACPDCEGLGIKLEVDEDLVVPDKSLT
LAEGALAPWNPISSQYYPEMLKQACEQLEIPMDVPYEDLSKADQQTVLYGSNGKTFHFHY
QNDFGGVRDVDAVFEGVINNVDRRYHETNSDFTRDVMRKYMTELTCQTCHGFRLNRKALS
VKVGGEHIGMVSDLAIGKELDFFNELSLSEQSLVIAKPILKEIRDRLSFLQNVGLAYLTL
SRSARTLSGGEAQRIRLATQIGSNLSGVLYILDEPSIGLHQRDNDRLIGSLKKMRDLGNT
LIVVEHDEDTMRAADYIVDIGPGAGENGGEVMAAGTPKQVARSRKSLTGQYLSGKRFIPL
PETRRPGNGKKIRITGAAENNLKQIDVDFPLGEFVVVTGVSGSGKSTLVNDVLKRVLAQK
LNRNSEKPGKYKSVSGIKNIERLVNIDQSPIGRTPRSNPATYTGVFDNIRDLFAQTNEAK
LRGYKKGRFSFNTKGGRCEACHGDGILKIEMNFLPDVFVPCEVCHGKQYNSETLEVEYKG
KNIADVLQMTASEAVKFFEPIPKIRRKLQTLVDVGLGYVKLGQPATTLSGGEAQRMKLAS
ELHKQQSGKNFYILDEPTTGLHSEDIRRLIGVLDRLVDAGNTVLIIEHNLDVVKSADYLI
DLGPEGGDGGGTIVATGTPEQVAEVAESYTGQYLKPVLERDRAREATAPAK
NT seq 2856 nt   +upstreamnt  +downstreamnt
ttggcaaatgataagattgtcattcacggtgcgcgagcccataatttaaaagatatcgac
gttaccatcccgcgcgacaaattagtcgtgattacggggctgtctggctcaggtaagagt
tcgttagcgttcgataccttgtacgcggaaggacaacgtcgctacgtggaaagtttgtca
gcgtacgcgcgtcaattcttaggacagatgcaaaaaccagacgttgattcaattgatggg
cttagtccggctatttcgatcgatcagaaaacaacatccaaaaacccgcgctcaacggtc
ggaaccgttacagaaatcaatgattatttacggttactgtgggcccgagtcggtgaaccg
atttgcccgaacgatgggacaccgattgcgagtcaaactgttgaacagatggttgatcgg
attcagaaattaccggaacgaacgaagttgcagattttatcaccaattgtccgccagaaa
aagggcgagcacaaaaagatctttgaaaagatcaagcgtgaaggtttcgtgcgggtccgt
gttgatggtgatattcatgatatcagtgaaacttttgaactgaacaagaatcaacaacac
acgattgaaatcgtcattgatcggatcgttgtgaagtcaggtgaccgttctcggttattt
gattcttttgaagcggcgttgcgattaagtgggggctatgcgattgcggatgtgatcggt
ggcgaacccattatgttctcagaacattatgcttgtcctatctgtgggtttactgtggga
gaacttgaaccacgattattctcgtttaacgcgcctcagggagcttgtccagactgtgaa
ggtctcggaatcaagctagaagtcgatgaggaccttgtcgtacctgataagtcgctgaca
ttggctgaaggtgcgttagcgccttggaatccaatcagttcacagtattatcctgaaatg
ttgaagcaagcttgtgaacagttagaaattccgatggatgtgccgtatgaagacttatca
aaagctgatcaacaaacggttttgtatgggtctaacggaaagacgttccatttccactac
cagaacgactttggtggtgttcgcgatgttgacgctgtgtttgagggcgttatcaacaat
gttgaccgccgctaccacgaaacgaatagtgatttcacccgcgatgtgatgcgaaagtat
atgacggaactcacttgtcagacttgtcatgggttccgcttaaatcgcaaggccctgtct
gtcaaagttggtggcgaacatatcgggatggtctctgacttagccattggtaaggaactc
gatttctttaacgagttgagcttatcagaacaaagtctcgtgattgctaaaccaatcttg
aaggaaatccgcgaccggttatcattcttgcaaaatgtgggactggcgtacttaacgctc
agccgttctgcacggacgctgtctggtggggaagcccagcgaatccggttagcaacacag
atcggatcgaacttgtccggcgtgctctatatcttggatgaaccatcaattggattgcat
cagcgggataacgaccgcttgattggttcacttaagaagatgcgcgatctggggaatacg
ttgatcgtggtcgaacatgatgaagacacgatgcgggccgctgactatatcgtggatatc
ggcccgggtgccggtgaaaacggtggtgaggtcatggcggccggaacgcccaagcaagtg
gctcgctcgcggaagtcactgaccggccaatatctatcgggcaaacggtttatcccacta
cctgaaactcggcgtccgggtaatggtaagaagattcgtatcactggtgcggccgaaaac
aacctcaagcaaattgacgttgattttccactaggcgaatttgtcgtggtaacgggggtt
tccggttctggtaagtcgaccttggttaacgatgttttgaaacgcgtattggcacagaag
ttgaatcgtaattctgaaaagcctggtaagtataagagtgtcagtggtattaagaatatt
gaacggttagttaatattgaccaaagtccaatcggccgaacaccacgcagtaatccggcc
acatatactggtgtctttgacaatattcgtgatttatttgcacaaacgaatgaagctaaa
ttacgtggttacaagaagggccgctttagttttaatactaagggtggtcgttgtgaggct
tgtcacggtgacgggattctaaaaattgaaatgaatttcttgcccgatgtctttgtacct
tgtgaagtgtgtcatggtaagcaatacaattctgaaacgttggaagttgaatacaaaggc
aaaaatattgccgatgttcttcaaatgaccgcttcagaagctgttaagttctttgaacca
attccaaagattcgacggaaactacagaccttggtcgacgttggtttgggctatgttaag
ttaggccaacccgccacgactttatcaggtggagaagcccaacggatgaagttagcttcc
gaattgcacaaacaacagtcggggaagaatttctacatcttggacgaaccaacgactggg
ttgcacagtgaagatattcggcgcttgattggtgtcttggatcggttggtggatgcgggt
aataccgtgttaatcatcgagcataatttggatgttgtgaagtcggcggattatttgatt
gacttgggcccagaaggcggtgacggcggcggaacaatcgttgctactgggacaccagaa
caggtcgctgaagtggctgaaagttatactggccaatacttgaagcccgttctagaacgg
gatcgagcacgtgaagcaactgcacctgctaaataa

DBGET integrated database retrieval system