KEGG   Lactobacillus plantarum WCFS1: lp_0814
Entry
lp_0814           CDS       T00115                                 

Gene name
murB
Definition
(RefSeq) UDP-N-acetylmuramate dehydrogenase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00520  Amino sugar and nucleotide sugar metabolism
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    lp_0814 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_0814 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_0814 (murB)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     lp_0814 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   lp_0814 (murB)
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-GeneID: 1063918
NCBI-ProteinID: YP_004888786
UniProt: Q88YF4
LinkDB
Position
753243..754151
AA seq 302 aa
MTKDVLATFPAIEIKKNESLSHYTNTKTGGPADYVAFPKSISETKALITFANEQNLPLTV
IGNASNLIVKDGGIRGLTIILTRMKQIHASGTKVVAEAGAAIIATTKVACGASLTGLEFA
AGIPGSVGGAIFMNAGAYGGEMSEVVETVTVLTPAGQLKTLDHDELDFGYRHSTIQDYDD
IVVSVTFGLKPGNQTKIQARMDELNTLRAAKQPLEWPSCGSVFKRPTGYFTGKLIHDAGL
QGHRIGGAEVSKKHAGFIINVDHATATDYMDMIHYVQKVVFERFGVHLQTEVRIIGEDVV
QG
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaccaaagatgtcttggccacttttccagccatcgaaattaaaaaaaatgaatcacta
agtcattatacgaatactaaaacaggcggtcccgccgattacgttgcgtttccaaagtca
atcagcgagacgaaagctctgattacgtttgccaatgagcaaaatttaccactaaccgtg
attggtaatgccagtaatttgattgtcaaagatggtggtatccgtggattaacgatcatt
ctcacccgcatgaagcaaattcatgcgagtggcaccaaagttgttgctgaagctggtgcc
gcaattattgcgacgactaaggttgcttgtggcgctagcttgactggtctcgaattcgca
gctgggattcccggtagtgtcgggggtgcgattttcatgaatgctggtgcgtacggcggc
gaaatgagtgaagttgttgaaacggtgacggttttgacgccagcgggtcagcttaaaacc
ctggatcatgacgaattagattttggctatcggcacagtacgatccaggactatgatgat
attgtcgtatcggtgacgtttggtctcaagccaggtaatcagaccaagattcaagcgcgg
atggacgaattgaatacgttgcgagcagccaaacaaccgttggaatggccatcatgcggg
agtgtttttaagcgaccaactgggtattttactggtaaactgattcatgatgctggctta
cagggccatcgaatcggtggtgctgaagtttctaagaaacacgcgggttttattatcaat
gtcgatcacgctacagcgaccgattatatggatatgattcactacgtccagaaagttgta
tttgaacggtttggcgtccatcttcagacggaagtccgaatcattggtgaagacgtcgtt
caaggttag

DBGET integrated database retrieval system